PLAT (NM_033011) Human Recombinant Protein
SKU
TP301146
Purified recombinant protein of Homo sapiens plasminogen activator, tissue (PLAT), transcript variant 3, 20 µg
$737.00
4 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC201146 protein sequence
Red=Cloning site Green=Tags(s) MDAMKRGLCCVLLLCGAVFVSPSQEIHARFRRGARSYQGCSEPRCFNGGTCQQALYFSDFVCQCPEGFAG KCCEIDTRATCYEDQGISYRGTWSTAESGAECTNWNSSALAQKPYSGRRPDAIRLGLGNHNYCRNPDRDS KPWCYVFKAGKYSSEFCSTPACSEGNSDCYFGNGSAYRGTHSLTESGASCLPWNSMILIGKVYTAQNPSA QALGLGKHNYCRNPDGDAKPWCHVLKNRRLTWEYCDVPSCSTCGLRQYSQPQFRIKGGLFADIASHPWQA AIFAKHRRSPGERFLCGGILISSCWILSAAHCFQERFPPHHLTVILGRTYRVVPGEEEQKFEVEKYIVHK EFDDDTYDNDIALLQLKSDSSRCAQESSVVRTVCLPPADLQLPDWTECELSGYGKHEALSPFYSERLKEA HVRLYPSSRCTSQHLLNRTVTDNMLCAGDTRSGGPQANLHDACQGDSGGPLVCLNDGRMTLVGIISWGLG CGQKDVPGVYTKVTNYLDWIRDNMRP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 54.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_127509 |
Locus ID | 5327 |
UniProt ID | P00750 |
Cytogenetics | 8p11.21 |
RefSeq Size | 3035 |
RefSeq ORF | 1548 |
Synonyms | T-PA; TPA |
Summary | This gene encodes tissue-type plasminogen activator, a secreted serine protease that converts the proenzyme plasminogen to plasmin, a fibrinolytic enzyme. The encoded preproprotein is proteolytically processed by plasmin or trypsin to generate heavy and light chains. These chains associate via disulfide linkages to form the heterodimeric enzyme. This enzyme plays a role in cell migration and tissue remodeling. Increased enzymatic activity causes hyperfibrinolysis, which manifests as excessive bleeding, while decreased activity leads to hypofibrinolysis, which can result in thrombosis or embolism. Alternative splicing of this gene results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Jan 2016] |
Protein Families | Druggable Genome, Protease, Secreted Protein |
Protein Pathways | Complement and coagulation cascades |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH301146 | PLAT MS Standard C13 and N15-labeled recombinant protein (NP_127509) | 10 ug |
$3,255.00
|
|
LC400338 | PLAT HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC409761 | PLAT HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY400338 | Transient overexpression lysate of plasminogen activator, tissue (PLAT), transcript variant 1 | 100 ug |
$436.00
|
|
LY409761 | Transient overexpression lysate of plasminogen activator, tissue (PLAT), transcript variant 3 | 100 ug |
$436.00
|
|
TP761399 | Purified recombinant protein of Human plasminogen activator, tissue (PLAT), transcript variant 3, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug | 50 ug |
$261.00
|
|
TP762208 | Purified recombinant protein of Human plasminogen activator, tissue (PLAT), transcript variant 1, Ala157-Val426, with N-terminal His tag, expressed in E.coli, 50ug | 50 ug |
$261.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.