PLAT (NM_033011) Human Mass Spec Standard

SKU
PH301146
PLAT MS Standard C13 and N15-labeled recombinant protein (NP_127509)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201146]
Predicted MW 57.4 kDa
Protein Sequence
Protein Sequence
>RC201146 protein sequence
Red=Cloning site Green=Tags(s)

MDAMKRGLCCVLLLCGAVFVSPSQEIHARFRRGARSYQGCSEPRCFNGGTCQQALYFSDFVCQCPEGFAG
KCCEIDTRATCYEDQGISYRGTWSTAESGAECTNWNSSALAQKPYSGRRPDAIRLGLGNHNYCRNPDRDS
KPWCYVFKAGKYSSEFCSTPACSEGNSDCYFGNGSAYRGTHSLTESGASCLPWNSMILIGKVYTAQNPSA
QALGLGKHNYCRNPDGDAKPWCHVLKNRRLTWEYCDVPSCSTCGLRQYSQPQFRIKGGLFADIASHPWQA
AIFAKHRRSPGERFLCGGILISSCWILSAAHCFQERFPPHHLTVILGRTYRVVPGEEEQKFEVEKYIVHK
EFDDDTYDNDIALLQLKSDSSRCAQESSVVRTVCLPPADLQLPDWTECELSGYGKHEALSPFYSERLKEA
HVRLYPSSRCTSQHLLNRTVTDNMLCAGDTRSGGPQANLHDACQGDSGGPLVCLNDGRMTLVGIISWGLG
CGQKDVPGVYTKVTNYLDWIRDNMRP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_127509
RefSeq Size 3035
RefSeq ORF 1548
Synonyms T-PA; TPA
Locus ID 5327
UniProt ID P00750
Cytogenetics 8p11.21
Summary This gene encodes tissue-type plasminogen activator, a secreted serine protease that converts the proenzyme plasminogen to plasmin, a fibrinolytic enzyme. The encoded preproprotein is proteolytically processed by plasmin or trypsin to generate heavy and light chains. These chains associate via disulfide linkages to form the heterodimeric enzyme. This enzyme plays a role in cell migration and tissue remodeling. Increased enzymatic activity causes hyperfibrinolysis, which manifests as excessive bleeding, while decreased activity leads to hypofibrinolysis, which can result in thrombosis or embolism. Alternative splicing of this gene results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Jan 2016]
Protein Families Druggable Genome, Protease, Secreted Protein
Protein Pathways Complement and coagulation cascades
Write Your Own Review
You're reviewing:PLAT (NM_033011) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400338 PLAT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC409761 PLAT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400338 Transient overexpression lysate of plasminogen activator, tissue (PLAT), transcript variant 1 100 ug
$436.00
LY409761 Transient overexpression lysate of plasminogen activator, tissue (PLAT), transcript variant 3 100 ug
$436.00
TP301146 Purified recombinant protein of Homo sapiens plasminogen activator, tissue (PLAT), transcript variant 3, 20 µg 20 ug
$737.00
TP761399 Purified recombinant protein of Human plasminogen activator, tissue (PLAT), transcript variant 3, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$261.00
TP762208 Purified recombinant protein of Human plasminogen activator, tissue (PLAT), transcript variant 1, Ala157-Val426, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.