SERBP1 (NM_001018067) Human Recombinant Protein

SKU
TP301092
Recombinant protein of human SERPINE1 mRNA binding protein 1 (SERBP1), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201092 representing NM_001018067
Red=Cloning site Green=Tags(s)

MPGHLQEGFGCVVTNRFDQLFDDESDPFEVLKAAENKKKEAGGGGVGGPGAKSAAQAAAQTNSNAAGKQL
RKESQKDRKNPLPPSVGVVDKKEETQPPVALKKEGIRRVGRRPDQQLQGEGKIIDRRPERRPPRERRFEK
PLEEKGEGGEFSVDRPIIDRPIRGRGGLGRGRGGRGRGMGRGDGFDSRGKREFDRHSGSDRSSFSHYSGL
KHEDKRGGSGSHNWGTVKDELTESPKYIQKQISYNYSDLDQSNVTEETPEGEEHHPVADTENKENEVEEV
KEEGPKEMTLDEWKAIQNKDRAKVEFNIRKPNEGADGQWKKGFVLHKSKSEEAHAEDSVMDHHFRKPAND
ITSQLEINFGDLGRPGRGGRGGRGGRGRGGRPNRGSRTDKSSASAPDVDDPEAFPALA

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 44.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001018077
Locus ID 26135
UniProt ID Q8NC51
Cytogenetics 1p31.3
RefSeq Size 6764
RefSeq ORF 1224
Synonyms CGI-55; CHD3IP; HABP4L; PAI-RBP1; PAIRBP1
Summary May play a role in the regulation of mRNA stability. Binds to the 3'-most 134 nt of the SERPINE1/PAI1 mRNA, a region which confers cyclic nucleotide regulation of message decay. Seems to play a role in PML-nuclear bodies formation (PubMed:28695742).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:SERBP1 (NM_001018067) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH301092 SERBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001018077) 10 ug
$3,255.00
PH303582 SERBP1 MS Standard C13 and N15-labeled recombinant protein (NP_056455) 10 ug
$3,255.00
PH304527 SERBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001018078) 10 ug
$3,255.00
LC402455 SERBP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422718 SERBP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422719 SERBP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422720 SERBP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402455 Transient overexpression lysate of SERPINE1 mRNA binding protein 1 (SERBP1), transcript variant 4 100 ug
$436.00
LY422718 Transient overexpression lysate of SERPINE1 mRNA binding protein 1 (SERBP1), transcript variant 1 100 ug
$436.00
LY422719 Transient overexpression lysate of SERPINE1 mRNA binding protein 1 (SERBP1), transcript variant 2 100 ug
$436.00
LY422720 Transient overexpression lysate of SERPINE1 mRNA binding protein 1 (SERBP1), transcript variant 3 100 ug
$436.00
TP303582 Recombinant protein of human SERPINE1 mRNA binding protein 1 (SERBP1), transcript variant 4, 20 µg 20 ug
$737.00
TP304527 Recombinant protein of human SERPINE1 mRNA binding protein 1 (SERBP1), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.