SERBP1 (NM_001018067) Human Recombinant Protein
SKU
TP301092
Recombinant protein of human SERPINE1 mRNA binding protein 1 (SERBP1), transcript variant 1, 20 µg
$737.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC201092 representing NM_001018067
Red=Cloning site Green=Tags(s) MPGHLQEGFGCVVTNRFDQLFDDESDPFEVLKAAENKKKEAGGGGVGGPGAKSAAQAAAQTNSNAAGKQL RKESQKDRKNPLPPSVGVVDKKEETQPPVALKKEGIRRVGRRPDQQLQGEGKIIDRRPERRPPRERRFEK PLEEKGEGGEFSVDRPIIDRPIRGRGGLGRGRGGRGRGMGRGDGFDSRGKREFDRHSGSDRSSFSHYSGL KHEDKRGGSGSHNWGTVKDELTESPKYIQKQISYNYSDLDQSNVTEETPEGEEHHPVADTENKENEVEEV KEEGPKEMTLDEWKAIQNKDRAKVEFNIRKPNEGADGQWKKGFVLHKSKSEEAHAEDSVMDHHFRKPAND ITSQLEINFGDLGRPGRGGRGGRGGRGRGGRPNRGSRTDKSSASAPDVDDPEAFPALA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 44.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001018077 |
Locus ID | 26135 |
UniProt ID | Q8NC51 |
Cytogenetics | 1p31.3 |
RefSeq Size | 6764 |
RefSeq ORF | 1224 |
Synonyms | CGI-55; CHD3IP; HABP4L; PAI-RBP1; PAIRBP1 |
Summary | May play a role in the regulation of mRNA stability. Binds to the 3'-most 134 nt of the SERPINE1/PAI1 mRNA, a region which confers cyclic nucleotide regulation of message decay. Seems to play a role in PML-nuclear bodies formation (PubMed:28695742).[UniProtKB/Swiss-Prot Function] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH301092 | SERBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001018077) | 10 ug |
$3,255.00
|
|
PH303582 | SERBP1 MS Standard C13 and N15-labeled recombinant protein (NP_056455) | 10 ug |
$3,255.00
|
|
PH304527 | SERBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001018078) | 10 ug |
$3,255.00
|
|
LC402455 | SERBP1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC422718 | SERBP1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC422719 | SERBP1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC422720 | SERBP1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY402455 | Transient overexpression lysate of SERPINE1 mRNA binding protein 1 (SERBP1), transcript variant 4 | 100 ug |
$436.00
|
|
LY422718 | Transient overexpression lysate of SERPINE1 mRNA binding protein 1 (SERBP1), transcript variant 1 | 100 ug |
$436.00
|
|
LY422719 | Transient overexpression lysate of SERPINE1 mRNA binding protein 1 (SERBP1), transcript variant 2 | 100 ug |
$436.00
|
|
LY422720 | Transient overexpression lysate of SERPINE1 mRNA binding protein 1 (SERBP1), transcript variant 3 | 100 ug |
$436.00
|
|
TP303582 | Recombinant protein of human SERPINE1 mRNA binding protein 1 (SERBP1), transcript variant 4, 20 µg | 20 ug |
$737.00
|
|
TP304527 | Recombinant protein of human SERPINE1 mRNA binding protein 1 (SERBP1), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.