DNAJB2 (NM_006736) Human Recombinant Protein
SKU
TP301081
Recombinant protein of human DnaJ (Hsp40) homolog, subfamily B, member 2 (DNAJB2), transcript variant 2, 20 µg
$564.00
MSRP
$867.00
MSRP
$867.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC201081 protein sequence
Red=Cloning site Green=Tags(s) MASYYEILDVPRSASADDIKKAYRRKALQWHPDKNPDNKEFAEKKFKEVAEAYEVLSDKHKREIYDRYGR EGLTGTGTGPSRAEAGSGGPGFTFTFRSPEEVFREFFGSGDPFAELFDDLGPFSELQNRGSRHSGPFFTF SSSFPGHSDFSSSSFSFSPGAGAFRSVSTSTTFVQGRRITTRRIMENGQERVEVEEDGQLKSVTINGVPD DLALGLELSRREQQPSVTSRSGGTQVQQTPASCPLDSDLSEDEDLQLAMAYSLSEMEAAGKKPAGGREAQ HRRQGRPKAQHQDPGLGGTQEGARGEATKRSPSPEEKASRCLIL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 35.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_006727 |
Locus ID | 3300 |
UniProt ID | P25686 |
Cytogenetics | 2q35 |
RefSeq Size | 3129 |
RefSeq ORF | 972 |
Synonyms | CMT2T; DSMA5; HSJ-1; HSJ1; HSPF3 |
Summary | This gene is almost exclusively expressed in the brain, mainly in the neuronal layers. It encodes a protein that shows sequence similarity to bacterial DnaJ protein and the yeast homologs. In bacteria, this protein is implicated in protein folding and protein complex dissociation. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2011] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH301081 | DNAJB2 MS Standard C13 and N15-labeled recombinant protein (NP_006727) | 10 ug |
$3,255.00
|
|
PH306769 | DNAJB2 MS Standard C13 and N15-labeled recombinant protein (NP_001034639) | 10 ug |
$3,255.00
|
|
LC416440 | DNAJB2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC422070 | DNAJB2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY416440 | Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily B, member 2 (DNAJB2), transcript variant 2 | 100 ug |
$436.00
|
|
LY422070 | Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily B, member 2 (DNAJB2), transcript variant 1 | 100 ug |
$436.00
|
|
TP306769 | Recombinant protein of human DnaJ (Hsp40) homolog, subfamily B, member 2 (DNAJB2), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.