DNAJB2 (NM_001039550) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC206769] |
Predicted MW | 30.6 kDa |
Protein Sequence |
Protein Sequence
>RC206769 protein sequence
Red=Cloning site Green=Tags(s) MASYYEILDVPRSASADDIKKAYRRKALQWHPDKNPDNKEFAEKKFKEVAEAYEVLSDKHKREIYDRYGR EGLTGTGTGPSRAEAGSGGPGFTFTFRSPEEVFREFFGSGDPFAELFDDLGPFSELQNRGSRHSGPFFTF SSSFPGHSDFSSSSFSFSPGAGAFRSVSTSTTFVQGRRITTRRIMENGQERVEVEEDGQLKSVTINGVPD DLALGLELSRREQQPSVTSRSGGTQVQQTPASCPLDSDLSEDEDLQLAMAYSLSEMEAAGKKPADVF myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001034639 |
RefSeq Size | 1978 |
RefSeq ORF | 831 |
Synonyms | CMT2T; DSMA5; HSJ-1; HSJ1; HSPF3 |
Locus ID | 3300 |
UniProt ID | P25686 |
Cytogenetics | 2q35 |
Summary | This gene is almost exclusively expressed in the brain, mainly in the neuronal layers. It encodes a protein that shows sequence similarity to bacterial DnaJ protein and the yeast homologs. In bacteria, this protein is implicated in protein folding and protein complex dissociation. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2011] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH301081 | DNAJB2 MS Standard C13 and N15-labeled recombinant protein (NP_006727) | 10 ug |
$3,255.00
|
|
LC416440 | DNAJB2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC422070 | DNAJB2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY416440 | Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily B, member 2 (DNAJB2), transcript variant 2 | 100 ug |
$436.00
|
|
LY422070 | Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily B, member 2 (DNAJB2), transcript variant 1 | 100 ug |
$436.00
|
|
TP301081 | Recombinant protein of human DnaJ (Hsp40) homolog, subfamily B, member 2 (DNAJB2), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP306769 | Recombinant protein of human DnaJ (Hsp40) homolog, subfamily B, member 2 (DNAJB2), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.