DNAJB2 (NM_001039550) Human Mass Spec Standard

SKU
PH306769
DNAJB2 MS Standard C13 and N15-labeled recombinant protein (NP_001034639)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206769]
Predicted MW 30.6 kDa
Protein Sequence
Protein Sequence
>RC206769 protein sequence
Red=Cloning site Green=Tags(s)

MASYYEILDVPRSASADDIKKAYRRKALQWHPDKNPDNKEFAEKKFKEVAEAYEVLSDKHKREIYDRYGR
EGLTGTGTGPSRAEAGSGGPGFTFTFRSPEEVFREFFGSGDPFAELFDDLGPFSELQNRGSRHSGPFFTF
SSSFPGHSDFSSSSFSFSPGAGAFRSVSTSTTFVQGRRITTRRIMENGQERVEVEEDGQLKSVTINGVPD
DLALGLELSRREQQPSVTSRSGGTQVQQTPASCPLDSDLSEDEDLQLAMAYSLSEMEAAGKKPADVF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001034639
RefSeq Size 1978
RefSeq ORF 831
Synonyms CMT2T; DSMA5; HSJ-1; HSJ1; HSPF3
Locus ID 3300
UniProt ID P25686
Cytogenetics 2q35
Summary This gene is almost exclusively expressed in the brain, mainly in the neuronal layers. It encodes a protein that shows sequence similarity to bacterial DnaJ protein and the yeast homologs. In bacteria, this protein is implicated in protein folding and protein complex dissociation. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2011]
Write Your Own Review
You're reviewing:DNAJB2 (NM_001039550) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH301081 DNAJB2 MS Standard C13 and N15-labeled recombinant protein (NP_006727) 10 ug
$3,255.00
LC416440 DNAJB2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422070 DNAJB2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416440 Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily B, member 2 (DNAJB2), transcript variant 2 100 ug
$436.00
LY422070 Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily B, member 2 (DNAJB2), transcript variant 1 100 ug
$436.00
TP301081 Recombinant protein of human DnaJ (Hsp40) homolog, subfamily B, member 2 (DNAJB2), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP306769 Recombinant protein of human DnaJ (Hsp40) homolog, subfamily B, member 2 (DNAJB2), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.