Hsp22 (HSPB8) (NM_014365) Human Recombinant Protein
CAT#: TP301040
Recombinant protein of human heat shock 22kDa protein 8 (HSPB8), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201040 protein sequence
Red=Cloning site Green=Tags(s) MADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVP RGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFT KKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 21.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_055180 |
Locus ID | 26353 |
UniProt ID | Q9UJY1 |
Cytogenetics | 12q24.23 |
Refseq Size | 2056 |
Refseq ORF | 588 |
Synonyms | CMT2L; DHMN2; E2IG1; H11; HMN2; HMN2A; HSP22 |
Summary | The protein encoded by this gene belongs to the superfamily of small heat-shock proteins containing a conservative alpha-crystallin domain at the C-terminal part of the molecule. The expression of this gene in induced by estrogen in estrogen receptor-positive breast cancer cells, and this protein also functions as a chaperone in association with Bag3, a stimulator of macroautophagy. Thus, this gene appears to be involved in regulation of cell proliferation, apoptosis, and carcinogenesis, and mutations in this gene have been associated with different neuromuscular diseases, including Charcot-Marie-Tooth disease. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Protein Kinase |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415329 | HSPB8 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY415329 | Transient overexpression lysate of heat shock 22kDa protein 8 (HSPB8) |
USD 436.00 |
|
PH301040 | HSPB8 MS Standard C13 and N15-labeled recombinant protein (NP_055180) |
USD 3,255.00 |
|
TP721206 | Purified recombinant protein of Human heat shock 22kDa protein 8 (HSPB8) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review