OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Hsp22 (HSPB8) (NM_014365) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP301040
Recombinant protein of human heat shock 22kDa protein 8 (HSPB8), 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA501210 HSPB8 (Hsp22) mouse monoclonal antibody, clone OTI1E3 (formerly 1E3) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Hsp22 or NM_014365"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201040 protein sequence
Red=Cloning site Green=Tags(s)

MADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVP
RGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFT
KKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 21.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_055180
Locus ID 26353
UniProt ID Q9UJY1
Cytogenetics 12q24.23
RefSeq Size 2056
RefSeq ORF 588
Synonyms CMT2L; DHMN2; E2IG1; H11; HMN2; HMN2A; HSP22
Summary The protein encoded by this gene belongs to the superfamily of small heat-shock proteins containing a conservative alpha-crystallin domain at the C-terminal part of the molecule. The expression of this gene in induced by estrogen in estrogen receptor-positive breast cancer cells, and this protein also functions as a chaperone in association with Bag3, a stimulator of macroautophagy. Thus, this gene appears to be involved in regulation of cell proliferation, apoptosis, and carcinogenesis, and mutations in this gene have been associated with different neuromuscular diseases, including Charcot-Marie-Tooth disease. provided by RefSeq, Jul 2008
Protein Categories Intracellular Proteins, Nervous system: Neurodegenerative diseases
Protein Families Druggable Genome, Protein Kinase
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Hsp22" proteins (4)
SKU Description Size Price
PH301040 HSPB8 MS Standard C13 and N15-labeled recombinant protein (NP_055180) 10 ug
$3,360.00
LC415329 Lyophilized HSPB8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415329 Transient overexpression lysate of heat shock 22kDa protein 8 (HSPB8) (as WB positive control) 100 ug
$436.00
TP721206 Purified recombinant protein of Human heat shock 22kDa protein 8 (HSPB8) 10 ug
$340.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products