Hsp22 (HSPB8) (NM_014365) Human Recombinant Protein

SKU
TP301040
Recombinant protein of human heat shock 22kDa protein 8 (HSPB8), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201040 protein sequence
Red=Cloning site Green=Tags(s)

MADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVP
RGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFT
KKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 21.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_055180
Locus ID 26353
UniProt ID Q9UJY1
Cytogenetics 12q24.23
RefSeq Size 2056
RefSeq ORF 588
Synonyms CMT2L; DHMN2; E2IG1; H11; HMN2; HMN2A; HSP22
Summary The protein encoded by this gene belongs to the superfamily of small heat-shock proteins containing a conservative alpha-crystallin domain at the C-terminal part of the molecule. The expression of this gene in induced by estrogen in estrogen receptor-positive breast cancer cells, and this protein also functions as a chaperone in association with Bag3, a stimulator of macroautophagy. Thus, this gene appears to be involved in regulation of cell proliferation, apoptosis, and carcinogenesis, and mutations in this gene have been associated with different neuromuscular diseases, including Charcot-Marie-Tooth disease. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Protein Kinase
Write Your Own Review
You're reviewing:Hsp22 (HSPB8) (NM_014365) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH301040 HSPB8 MS Standard C13 and N15-labeled recombinant protein (NP_055180) 10 ug
$3,255.00
LC415329 HSPB8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415329 Transient overexpression lysate of heat shock 22kDa protein 8 (HSPB8) 100 ug
$436.00
TP721206 Purified recombinant protein of Human heat shock 22kDa protein 8 (HSPB8) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.