Hsp22 (HSPB8) (NM_014365) Human Tagged ORF Clone

SKU
RC201040
HSPB8 (Myc-DDK-tagged)-Human heat shock 22kDa protein 8 (HSPB8)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$450.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Hsp22
Synonyms CMT2L; DHMN2; E2IG1; H11; HMN2; HMN2A; HSP22
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201040 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGACGGTCAGATGCCCTTCTCCTGCCACTACCCAAGCCGCCTGCGCCGAGACCCCTTCCGGGACT
CTCCCCTCTCCTCTCGCCTGCTGGATGATGGCTTTGGCATGGACCCCTTCCCAGACGACTTGACAGCCTC
TTGGCCCGACTGGGCTCTGCCTCGTCTCTCCTCCGCCTGGCCAGGCACCCTAAGGTCGGGCATGGTGCCC
CGGGGCCCCACTGCCACCGCCAGGTTTGGGGTGCCTGCCGAGGGCAGGACCCCCCCACCCTTCCCTGGGG
AGCCCTGGAAAGTGTGTGTGAATGTGCACAGCTTCAAGCCAGAGGAGTTGATGGTGAAGACCAAAGATGG
ATACGTGGAGGTGTCTGGCAAACATGAAGAGAAACAGCAAGAAGGTGGCATTGTTTCTAAGAACTTCACA
AAGAAAATCCAGCTTCCTGCAGAGGTGGATCCTGTGACAGTATTTGCCTCACTTTCCCCAGAGGGTCTGC
TGATCATCGAAGCTCCCCAGGTCCCTCCTTACTCAACATTTGGAGAGAGCAGTTTCAACAACGAGCTTCC
CCAGGACAGCCAGGAAGTCACCTGTACC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201040 protein sequence
Red=Cloning site Green=Tags(s)

MADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVP
RGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFT
KKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_014365
ORF Size 588 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_014365.3
RefSeq Size 2056 bp
RefSeq ORF 591 bp
Locus ID 26353
UniProt ID Q9UJY1
Cytogenetics 12q24.23
Domains HSP20
Protein Families Druggable Genome, Protein Kinase
MW 21.6 kDa
Summary The protein encoded by this gene belongs to the superfamily of small heat-shock proteins containing a conservative alpha-crystallin domain at the C-terminal part of the molecule. The expression of this gene in induced by estrogen in estrogen receptor-positive breast cancer cells, and this protein also functions as a chaperone in association with Bag3, a stimulator of macroautophagy. Thus, this gene appears to be involved in regulation of cell proliferation, apoptosis, and carcinogenesis, and mutations in this gene have been associated with different neuromuscular diseases, including Charcot-Marie-Tooth disease. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:Hsp22 (HSPB8) (NM_014365) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201040L1 Lenti ORF clone of Human heat shock 22kDa protein 8 (HSPB8), Myc-DDK-tagged 10 ug
$750.00
RC201040L2 Lenti ORF clone of Human heat shock 22kDa protein 8 (HSPB8), mGFP tagged 10 ug
$750.00
RC201040L3 Lenti ORF clone of Human heat shock 22kDa protein 8 (HSPB8), Myc-DDK-tagged 10 ug
$750.00
RC201040L4 Lenti ORF clone of Human heat shock 22kDa protein 8 (HSPB8), mGFP tagged 10 ug
$750.00
RG201040 HSPB8 (tGFP-tagged) - Human heat shock 22kDa protein 8 (HSPB8) 10 ug
$489.00 MSRP $650.00 MSRP $650.00
SC115063 HSPB8 (untagged)-Human heat shock 22kDa protein 8 (HSPB8) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.