SCNM1 (NM_024041) Human Recombinant Protein

SKU
TP300987
Recombinant protein of human sodium channel modifier 1 (SCNM1), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200987 protein sequence
Red=Cloning site Green=Tags(s)

MSFKREGDDWSQLNVLKKRRVGDLLASYIPEDEALMLRDGRFACAICPHRPVLDTLAMLTAHRAGKKHLS
SLQLFYGKKQPGKERKQNPKHQNELRREETKAEAPLLTQTRLITQSALHRAPHYNSCCRRKYRPEAPGPS
VSLSPMPPSEVKLQSGKISREPEPAAGPQAEESATVSAPAPMSPTRRRALDHYLTLRSSGWIPDGRGRWV
KDENVEFDSDEEEPPDLPLD

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 25.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_076946
Locus ID 79005
UniProt ID Q9BWG6
Cytogenetics 1q21.3
RefSeq Size 2036
RefSeq ORF 690
Summary SCNM1 is a zinc finger protein and putative splicing factor. In mice, Scnm1 modifies phenotypic expression of Scn8a (MIM 600702) mutations (Buchner et al., 2003 [PubMed 12920299]).[supplied by OMIM, Oct 2009]
Write Your Own Review
You're reviewing:SCNM1 (NM_024041) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH300987 SCNM1 MS Standard C13 and N15-labeled recombinant protein (NP_076946) 10 ug
$3,255.00
LC411417 SCNM1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411417 Transient overexpression lysate of sodium channel modifier 1 (SCNM1) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.