SCNM1 (NM_024041) Human Mass Spec Standard

SKU
PH300987
SCNM1 MS Standard C13 and N15-labeled recombinant protein (NP_076946)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200987]
Predicted MW 25.9 kDa
Protein Sequence
Protein Sequence
>RC200987 protein sequence
Red=Cloning site Green=Tags(s)

MSFKREGDDWSQLNVLKKRRVGDLLASYIPEDEALMLRDGRFACAICPHRPVLDTLAMLTAHRAGKKHLS
SLQLFYGKKQPGKERKQNPKHQNELRREETKAEAPLLTQTRLITQSALHRAPHYNSCCRRKYRPEAPGPS
VSLSPMPPSEVKLQSGKISREPEPAAGPQAEESATVSAPAPMSPTRRRALDHYLTLRSSGWIPDGRGRWV
KDENVEFDSDEEEPPDLPLD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_076946
RefSeq Size 2036
RefSeq ORF 690
Locus ID 79005
UniProt ID Q9BWG6
Cytogenetics 1q21.3
Summary SCNM1 is a zinc finger protein and putative splicing factor. In mice, Scnm1 modifies phenotypic expression of Scn8a (MIM 600702) mutations (Buchner et al., 2003 [PubMed 12920299]).[supplied by OMIM, Oct 2009]
Write Your Own Review
You're reviewing:SCNM1 (NM_024041) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC411417 SCNM1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411417 Transient overexpression lysate of sodium channel modifier 1 (SCNM1) 100 ug
$436.00
TP300987 Recombinant protein of human sodium channel modifier 1 (SCNM1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.