NUDT21 (NM_007006) Human Recombinant Protein

SKU
TP300936
Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 21 (NUDT21), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200936 protein sequence
Red=Cloning site Green=Tags(s)

MSVVPPNRSQTGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREE
FDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWV
IDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGP
IISSLPQLLSRFNFIYN

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 26 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_008937
Locus ID 11051
UniProt ID O43809
Cytogenetics 16q13
RefSeq Size 4407
RefSeq ORF 681
Synonyms CFIM25; CPSF5
Summary The protein encoded by this gene is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitment of other processing factors. This gene encodes the 25kD subunit of the protein complex, which is composed of four polypeptides. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:NUDT21 (NM_007006) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH300936 NUDT21 MS Standard C13 and N15-labeled recombinant protein (NP_008937) 10 ug
$3,255.00
LC416262 NUDT21 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416262 Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 21 (NUDT21) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.