NUDT21 (NM_007006) Human Tagged ORF Clone

SKU
RC200936
NUDT21 (Myc-DDK-tagged)-Human nudix (nucleoside diphosphate linked moiety X)-type motif 21 (NUDT21)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol NUDT21
Synonyms CFIM25; CPSF5
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200936 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTGTGGTACCGCCCAATCGCTCGCAGACCGGCTGGCCCCGGGGGGTCACTCAGTTCGGCAACAAGT
ACATCCAGCAGACGAAGCCCCTCACCCTGGAGCGCACCATCAACCTGTACCCTCTTACCAATTATACTTT
TGGTACAAAAGAGCCCCTCTACGAGAAGGACAGCTCTGTTGCAGCCAGATTTCAGCGCATGAGGGAAGAA
TTTGATAAAATTGGAATGAGGAGGACTGTAGAAGGGGTTCTGATTGTACATGAGCACCGGCTACCCCATG
TGTTACTGCTGCAGCTGGGAACAACTTTCTTCAAACTACCTGGTGGTGAACTTAACCCAGGAGAAGATGA
AGTTGAAGGACTAAAACGCTTAATGACAGAGATACTGGGTCGTCAGGATGGAGTTTTGCAAGACTGGGTC
ATTGACGATTGCATTGGTAACTGGTGGAGACCAAATTTTGAACCTCCTCAGTATCCATATATTCCTGCAC
ATATTACAAAGCCTAAGGAACATAAGAAGTTGTTTCTGGTTCAGCTTCAAGAAAAAGCCTTGTTTGCAGT
CCCTAAAAATTACAAGCTGGTAGCTGCACCATTGTTTGAATTGTATGACAATGCACCAGGATATGGACCC
ATCATTTCTAGTCTCCCTCAGCTGTTGAGCAGGTTCAATTTTATTTACAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200936 protein sequence
Red=Cloning site Green=Tags(s)

MSVVPPNRSQTGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREE
FDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWV
IDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGP
IISSLPQLLSRFNFIYN

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_007006
ORF Size 681 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_007006.3
RefSeq Size 4407 bp
RefSeq ORF 684 bp
Locus ID 11051
UniProt ID O43809
Cytogenetics 16q13
Domains NUDIX
MW 26.2 kDa
Summary The protein encoded by this gene is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitment of other processing factors. This gene encodes the 25kD subunit of the protein complex, which is composed of four polypeptides. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:NUDT21 (NM_007006) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200936L1 Lenti ORF clone of Human nudix (nucleoside diphosphate linked moiety X)-type motif 21 (NUDT21), Myc-DDK-tagged 10 ug
$600.00
RC200936L2 Lenti ORF clone of Human nudix (nucleoside diphosphate linked moiety X)-type motif 21 (NUDT21), mGFP tagged 10 ug
$600.00
RC200936L3 Lenti ORF clone of Human nudix (nucleoside diphosphate linked moiety X)-type motif 21 (NUDT21), Myc-DDK-tagged 10 ug
$600.00
RC200936L4 Lenti ORF clone of Human nudix (nucleoside diphosphate linked moiety X)-type motif 21 (NUDT21), mGFP tagged 10 ug
$600.00
RG200936 NUDT21 (tGFP-tagged) - Human nudix (nucleoside diphosphate linked moiety X)-type motif 21 (NUDT21) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC115739 NUDT21 (untagged)-Human nudix (nucleoside diphosphate linked moiety X)-type motif 21 (NUDT21) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.