OTUD5 (NM_017602) Human Recombinant Protein

SKU
TP300893
Recombinant protein of human OTU domain containing 5 (OTUD5), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200893 representing NM_017602
Red=Cloning site Green=Tags(s)

MTILPKKKPPPPDADPANEPPPPGPMPPAPRRGGGVGVGGGGTGVGGGDRDRDSGVVGARPRASPPPQGP
LPGPPGALHRWALAVPPGAVAGPRPQQASPPPCGGPGGPGGGPGDALGAAAAGVGAAGVVVGVGGAVGVG
GCCSGPGHSKRRRQAPGVGAVGGGSPEREEVGAGYNSEDEYEAAAARIEAMDPATVEQQEHWFEKALRDK
KGFIIKQMKEDGACLFRAVADQVYGDQDMHEVVRKHCMDYLMKNADYFSNYVTEDFTTYINRKRKNNCHG
NHIEMQAMAEMYNRPVEVYQYSTGTSAVEPINTFHGIHQNEDEPIRVSYHRNIHYNSVVNPNKATIGVGL
GLPSFKPGFAEQSLMKNAIKTSEESWIEQQMLEDKKRATDWEATNEAIEEQVARESYLQWLRDQEKQARQ
VRGPSQPRKASATCSSATAAASSGLEEWTSRSPRQRSSASSPEHPELHAELGMKPPSPGTVLALAKPPSP
CAPGTSSQFSAGADRATSPLVSLYPALECRALIQQMSPSAFGLNDWDDDEILASVLAVSQQEYLDSMKKN
KVHRDPPPDKS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 60.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_060072
Locus ID 55593
UniProt ID Q96G74
Cytogenetics Xp11.23
RefSeq Size 2759
RefSeq ORF 1713
Synonyms DUBA; MCAND
Summary This gene encodes a member of the OTU (ovarian tumor) domain-containing cysteine protease superfamily. The OTU domain confers deubiquitinase activity and the encoded protein has been shown to suppress the type I interferon-dependent innate immune response by cleaving the polyubiquitin chain from an essential type I interferon adaptor protein. Cleavage results in disassociation of the adaptor protein from a downstream signaling complex and disruption of the type I interferon signaling cascade. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Oct 2008]
Protein Families Protease
Protein Pathways RIG-I-like receptor signaling pathway
Write Your Own Review
You're reviewing:OTUD5 (NM_017602) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH300893 OTUD5 MS Standard C13 and N15-labeled recombinant protein (NP_060072) 10 ug
$3,255.00
LC413689 OTUD5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427830 OTUD5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427831 OTUD5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427832 OTUD5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413689 Transient overexpression lysate of OTU domain containing 5 (OTUD5), transcript variant 1 100 ug
$436.00
LY427830 Transient overexpression lysate of OTU domain containing 5 (OTUD5), transcript variant 2 100 ug
$436.00
LY427831 Transient overexpression lysate of OTU domain containing 5 (OTUD5), transcript variant 3 100 ug
$436.00
LY427832 Transient overexpression lysate of OTU domain containing 5 (OTUD5), transcript variant 4 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.