OTUD5 (NM_017602) Human Mass Spec Standard

SKU
PH300893
OTUD5 MS Standard C13 and N15-labeled recombinant protein (NP_060072)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200893]
Predicted MW 60.4 kDa
Protein Sequence
Protein Sequence
>RC200893 representing NM_017602
Red=Cloning site Green=Tags(s)

MTILPKKKPPPPDADPANEPPPPGPMPPAPRRGGGVGVGGGGTGVGGGDRDRDSGVVGARPRASPPPQGP
LPGPPGALHRWALAVPPGAVAGPRPQQASPPPCGGPGGPGGGPGDALGAAAAGVGAAGVVVGVGGAVGVG
GCCSGPGHSKRRRQAPGVGAVGGGSPEREEVGAGYNSEDEYEAAAARIEAMDPATVEQQEHWFEKALRDK
KGFIIKQMKEDGACLFRAVADQVYGDQDMHEVVRKHCMDYLMKNADYFSNYVTEDFTTYINRKRKNNCHG
NHIEMQAMAEMYNRPVEVYQYSTGTSAVEPINTFHGIHQNEDEPIRVSYHRNIHYNSVVNPNKATIGVGL
GLPSFKPGFAEQSLMKNAIKTSEESWIEQQMLEDKKRATDWEATNEAIEEQVARESYLQWLRDQEKQARQ
VRGPSQPRKASATCSSATAAASSGLEEWTSRSPRQRSSASSPEHPELHAELGMKPPSPGTVLALAKPPSP
CAPGTSSQFSAGADRATSPLVSLYPALECRALIQQMSPSAFGLNDWDDDEILASVLAVSQQEYLDSMKKN
KVHRDPPPDKS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060072
RefSeq Size 2759
RefSeq ORF 1713
Synonyms DUBA; MCAND
Locus ID 55593
UniProt ID Q96G74
Cytogenetics Xp11.23
Summary This gene encodes a member of the OTU (ovarian tumor) domain-containing cysteine protease superfamily. The OTU domain confers deubiquitinase activity and the encoded protein has been shown to suppress the type I interferon-dependent innate immune response by cleaving the polyubiquitin chain from an essential type I interferon adaptor protein. Cleavage results in disassociation of the adaptor protein from a downstream signaling complex and disruption of the type I interferon signaling cascade. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Oct 2008]
Protein Families Protease
Protein Pathways RIG-I-like receptor signaling pathway
Write Your Own Review
You're reviewing:OTUD5 (NM_017602) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC413689 OTUD5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427830 OTUD5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427831 OTUD5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427832 OTUD5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413689 Transient overexpression lysate of OTU domain containing 5 (OTUD5), transcript variant 1 100 ug
$436.00
LY427830 Transient overexpression lysate of OTU domain containing 5 (OTUD5), transcript variant 2 100 ug
$436.00
LY427831 Transient overexpression lysate of OTU domain containing 5 (OTUD5), transcript variant 3 100 ug
$436.00
LY427832 Transient overexpression lysate of OTU domain containing 5 (OTUD5), transcript variant 4 100 ug
$436.00
TP300893 Recombinant protein of human OTU domain containing 5 (OTUD5), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.