PRP19 (PRPF19) (NM_014502) Human Recombinant Protein

SKU
TP300810
Recombinant protein of human PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) (PRPF19), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200810 protein sequence
Red=Cloning site Green=Tags(s)

MSLICSISNEVPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHPIRPKPPSATS
IPAILKALQDEWDAVMLHSFTLRQQLQTTRQELSHALYQHDAACRVIARLTKEVTAAREALATLKPQAGL
IVPQAVPSSQPSVVGAGEPMDLGELVGMTPEIIQKLQDKATVLTTERKKRGKTVPEELVKPEELSKYRQV
ASHVGLHSASIPGILALDLCPSDTNKILTGGADKNVVVFDKSSEQILATLKGHTKKVTSVVFHPSQDLVF
SASPDATIRIWSVPNASCVQVVRAHESAVTGLSLHATGDYLLSSSDDQYWAFSDIQTGRVLTKVTDETSG
CSLTCAQFHPDGLIFGTGTMDSQIKIWDLKERTNVANFPGHSGPITSIAFSENGYYLATAADDSSVKLWD
LRKLKNFKTLQLDNNFEVKSLIFDQSGTYLALGGTDVQIYICKQWTEILHFTEHSGLTTGVAFGHHAKFI
ASTGMDRSLKFYSL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 55 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_055317
Locus ID 27339
UniProt ID Q9UMS4
Cytogenetics 11q12.2
RefSeq Size 2342
RefSeq ORF 1512
Synonyms hPSO4; NMP200; PRP19; PSO4; SNEV; UBOX4
Summary PSO4 is the human homolog of yeast Pso4, a gene essential for cell survival and DNA repair (Beck et al., 2008 [PubMed 18263876]).[supplied by OMIM, Sep 2008]
Protein Families Druggable Genome
Protein Pathways Spliceosome, Ubiquitin mediated proteolysis
Write Your Own Review
You're reviewing:PRP19 (PRPF19) (NM_014502) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH300810 PRPF19 MS Standard C13 and N15-labeled recombinant protein (NP_055317) 10 ug
$3,255.00
LC402343 PRPF19 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402343 Transient overexpression lysate of PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) (PRPF19) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.