OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PRP19 (PRPF19) (NM_014502) Human Mass Spec Standard

Be the first to review this product
SKU
PH300810
PRPF19 MS Standard C13 and N15-labeled recombinant protein (NP_055317)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA380406 PRP19 Rabbit polyclonal Antibody
100 ul
$410.00
LY402343 Transient overexpression lysate of PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) (PRPF19) (as WB positive control) 100 ug
$436.00

Other products for "PRP19 or NM_014502"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200810
Predicted MW 55.2 kDa
Protein Sequence
Protein Sequence
>RC200810 protein sequence
Red=Cloning site Green=Tags(s)

MSLICSISNEVPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHPIRPKPPSATS
IPAILKALQDEWDAVMLHSFTLRQQLQTTRQELSHALYQHDAACRVIARLTKEVTAAREALATLKPQAGL
IVPQAVPSSQPSVVGAGEPMDLGELVGMTPEIIQKLQDKATVLTTERKKRGKTVPEELVKPEELSKYRQV
ASHVGLHSASIPGILALDLCPSDTNKILTGGADKNVVVFDKSSEQILATLKGHTKKVTSVVFHPSQDLVF
SASPDATIRIWSVPNASCVQVVRAHESAVTGLSLHATGDYLLSSSDDQYWAFSDIQTGRVLTKVTDETSG
CSLTCAQFHPDGLIFGTGTMDSQIKIWDLKERTNVANFPGHSGPITSIAFSENGYYLATAADDSSVKLWD
LRKLKNFKTLQLDNNFEVKSLIFDQSGTYLALGGTDVQIYICKQWTEILHFTEHSGLTTGVAFGHHAKFI
ASTGMDRSLKFYSL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055317
RefSeq Size 2342
RefSeq ORF 1512
Synonyms hPSO4; NMP200; PRP19; PSO4; SNEV; UBOX4
Locus ID 27339
UniProt ID Q9UMS4
Cytogenetics 11q12.2
Summary PSO4 is the human homolog of yeast Pso4, a gene essential for cell survival and DNA repair (Beck et al., 2008 PubMed 18263876).supplied by OMIM, Sep 2008
Protein Families Druggable Genome
Protein Pathways Spliceosome, Ubiquitin mediated proteolysis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PRP19" proteins (3)
SKU Description Size Price
LC402343 Lyophilized PRPF19 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402343 Transient overexpression lysate of PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) (PRPF19) (as WB positive control) 100 ug
$436.00
TP300810 Recombinant protein of human PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) (PRPF19), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products