C3orf10 (BRK1) (NM_018462) Human Recombinant Protein

SKU TP300804

Recombinant protein of human chromosome 3 open reading frame 10 (C3orf10), 20 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200804 protein sequence; Red=Cloning site Green=Tags(s); ; MAGQEDPVQREIHQDWANREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTK; GETLT; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 8.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_060932
• Locus ID: 55845
• UniProt ID: Q8WUW1
• Cytogenetics: 3p25.3
• RefSeq Size: 1197
• RefSeq ORF: 225
• Synonyms: C3orf10; hHBrk1; HSPC300; MDS027
• Summary: Involved in regulation of actin and microtubule organization. Part of a WAVE complex that activates the Arp2/3 complex. As component of the WAVE1 complex, required for BDNF-NTRK2 endocytic trafficking and signaling from early endosomes (By similarity).[UniProtKB/Swiss-Prot Function]
• Protein Pathways: Regulation of actin cytoskeleton