C3orf10 (BRK1) (NM_018462) Human Tagged ORF Clone

SKU
RC200804
BRK1 (Myc-DDK-tagged)-Human chromosome 3 open reading frame 10 (C3orf10)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol C3orf10
Synonyms C3orf10; hHBrk1; HSPC300; MDS027
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200804 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGGACAGGAGGATCCGGTGCAGCGGGAGATTCACCAGGACTGGGCTAACCGGGAGTACATTGAGA
TAATCACCAGCAGCATCAAGAAAATCGCAGACTTTCTCAACTCGTTCGATATGTCTTGTCGTTCAAGACT
TGCAACACTAAACGAGAAATTGACAGCCCTTGAACGGAGAATAGAGTACATTGAAGCTCGGGTGACAAAA
GGTGAGACACTCACC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200804 protein sequence
Red=Cloning site Green=Tags(s)

MAGQEDPVQREIHQDWANREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTK
GETLT

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_018462
ORF Size 225 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_018462.5
RefSeq Size 1197 bp
RefSeq ORF 228 bp
Locus ID 55845
UniProt ID Q8WUW1
Cytogenetics 3p25.3
Protein Pathways Regulation of actin cytoskeleton
MW 8.7 kDa
Summary Involved in regulation of actin and microtubule organization. Part of a WAVE complex that activates the Arp2/3 complex. As component of the WAVE1 complex, required for BDNF-NTRK2 endocytic trafficking and signaling from early endosomes (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:C3orf10 (BRK1) (NM_018462) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200804L3 Lenti ORF clone of Human chromosome 3 open reading frame 10 (C3orf10), Myc-DDK-tagged 10 ug
$450.00
RC200804L4 Lenti ORF clone of Human chromosome 3 open reading frame 10 (C3orf10), mGFP tagged 10 ug
$450.00
RG200804 BRK1 (tGFP-tagged) - Human chromosome 3 open reading frame 10 (C3orf10) 10 ug
$489.00
SC111347 BRK1 (untagged)-Human chromosome 3 open reading frame 10 (C3orf10) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.