MANBAL (NM_001003897) Human Recombinant Protein

SKU
TP300796
Recombinant protein of human mannosidase, beta A, lysosomal-like (MANBAL), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200796 protein sequence
Red=Cloning site Green=Tags(s)

MASDLDFSPPEVPEPTFLENLLRYGLFLGAIFQLICVLAIIVPIPKSHEAEAEPSEPRSAEVTRKPKAAV
PSVNKRPKKETKKKR

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 9.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001003897
Locus ID 63905
UniProt ID Q9NQG1
Cytogenetics 20q11.23
RefSeq Size 1268
RefSeq ORF 255
Protein Families Transmembrane
Write Your Own Review
You're reviewing:MANBAL (NM_001003897) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH300796 MANBAL MS Standard C13 and N15-labeled recombinant protein (NP_001003897) 10 ug
$3,255.00
PH305099 MANBAL MS Standard C13 and N15-labeled recombinant protein (NP_071360) 10 ug
$3,255.00
LC411800 MANBAL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424033 MANBAL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411800 Transient overexpression lysate of mannosidase, beta A, lysosomal-like (MANBAL), transcript variant 1 100 ug
$436.00
LY424033 Transient overexpression lysate of mannosidase, beta A, lysosomal-like (MANBAL), transcript variant 2 100 ug
$436.00
TP305099 Recombinant protein of human mannosidase, beta A, lysosomal-like (MANBAL), transcript variant 1, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.