MANBAL (NM_022077) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC205099] |
Predicted MW | 9.5 kDa |
Protein Sequence |
Protein Sequence
>RC205099 protein sequence
Red=Cloning site Green=Tags(s) MASDLDFSPPEVPEPTFLENLLRYGLFLGAIFQLICVLAIIVPIPKSHEAEAEPSEPRSAEVTRKPKAAV PSVNKRPKKETKKKR myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_071360 |
RefSeq Size | 1385 |
RefSeq ORF | 255 |
Locus ID | 63905 |
UniProt ID | Q9NQG1 |
Cytogenetics | 20q11.23 |
Protein Families | Transmembrane |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH300796 | MANBAL MS Standard C13 and N15-labeled recombinant protein (NP_001003897) | 10 ug |
$3,255.00
|
|
LC411800 | MANBAL HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC424033 | MANBAL HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY411800 | Transient overexpression lysate of mannosidase, beta A, lysosomal-like (MANBAL), transcript variant 1 | 100 ug |
$436.00
|
|
LY424033 | Transient overexpression lysate of mannosidase, beta A, lysosomal-like (MANBAL), transcript variant 2 | 100 ug |
$436.00
|
|
TP300796 | Recombinant protein of human mannosidase, beta A, lysosomal-like (MANBAL), transcript variant 2, 20 µg | 20 ug |
$867.00
|
|
TP305099 | Recombinant protein of human mannosidase, beta A, lysosomal-like (MANBAL), transcript variant 1, 20 µg | 20 ug |
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.