ICAM4 (NM_001039132) Human Recombinant Protein

SKU
TP300636
Recombinant protein of human intercellular adhesion molecule 4 (Landsteiner-Wiener blood group) (ICAM4), transcript variant 3, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200636 protein sequence
Red=Cloning site Green=Tags(s)

MGSLFPLSLLFFLAAAYPGVGSALGRRTKRAQSPKGSPLAPSGTSVPFWVRMSPEFVAVQPGKSVQLNCS
NSCPQPQNSSLRTPLRQGKTLRGPGWVSYQLLDVRAWSSLAHCLVTCAGKTRWATSRITAYSVPGGLLGG
DPEAWKPGHLFRKPGALHRPGSGQRDLDLRVCCWTPRLLAARDLPRAPQSRRPGGPQQLGTHYTDARLEP
RAHSFGLRFHRCPCRDPPHCGRCVPMQVPSYEVPGVKGDVLCRLSEKKRNMKQSGEMAIHGG

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 27.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001034221
Locus ID 3386
UniProt ID Q14773
Cytogenetics 19p13.2
RefSeq Size 1277
RefSeq ORF 816
Synonyms CD242; LW
Summary This gene encodes the Landsteiner-Wiener (LW) blood group antigen(s) that belongs to the immunoglobulin (Ig) superfamily, and that shares similarity with the intercellular adhesion molecule (ICAM) protein family. This ICAM protein contains 2 Ig-like C2-type domains and binds to the leukocyte adhesion LFA-1 protein. The molecular basis of the LW(A)/LW(B) blood group antigens is a single aa variation at position 100; Gln-100=LW(A) and Arg-100=LW(B). Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2008]
Protein Families Secreted Protein, Transmembrane
Write Your Own Review
You're reviewing:ICAM4 (NM_001039132) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH300636 ICAM4 MS Standard C13 and N15-labeled recombinant protein (NP_001034221) 10 ug
$3,255.00
LC411697 ICAM4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC419874 ICAM4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422020 ICAM4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411697 Transient overexpression lysate of intercellular adhesion molecule 4 (Landsteiner-Wiener blood group) (ICAM4), transcript variant 2 100 ug
$436.00
LY419874 Transient overexpression lysate of intercellular adhesion molecule 4 (Landsteiner-Wiener blood group) (ICAM4), transcript variant 1 100 ug
$436.00
LY422020 Transient overexpression lysate of intercellular adhesion molecule 4 (Landsteiner-Wiener blood group) (ICAM4), transcript variant 3 100 ug
$436.00
TP761371 Purified recombinant protein of Human intercellular adhesion molecule 4 (Landsteiner-Wiener blood group) (ICAM4), transcript variant 1, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.