ICAM4 (NM_001039132) Human Recombinant Protein
SKU
TP300636
Recombinant protein of human intercellular adhesion molecule 4 (Landsteiner-Wiener blood group) (ICAM4), transcript variant 3, 20 µg
$737.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC200636 protein sequence
Red=Cloning site Green=Tags(s) MGSLFPLSLLFFLAAAYPGVGSALGRRTKRAQSPKGSPLAPSGTSVPFWVRMSPEFVAVQPGKSVQLNCS NSCPQPQNSSLRTPLRQGKTLRGPGWVSYQLLDVRAWSSLAHCLVTCAGKTRWATSRITAYSVPGGLLGG DPEAWKPGHLFRKPGALHRPGSGQRDLDLRVCCWTPRLLAARDLPRAPQSRRPGGPQQLGTHYTDARLEP RAHSFGLRFHRCPCRDPPHCGRCVPMQVPSYEVPGVKGDVLCRLSEKKRNMKQSGEMAIHGG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 27.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001034221 |
Locus ID | 3386 |
UniProt ID | Q14773 |
Cytogenetics | 19p13.2 |
RefSeq Size | 1277 |
RefSeq ORF | 816 |
Synonyms | CD242; LW |
Summary | This gene encodes the Landsteiner-Wiener (LW) blood group antigen(s) that belongs to the immunoglobulin (Ig) superfamily, and that shares similarity with the intercellular adhesion molecule (ICAM) protein family. This ICAM protein contains 2 Ig-like C2-type domains and binds to the leukocyte adhesion LFA-1 protein. The molecular basis of the LW(A)/LW(B) blood group antigens is a single aa variation at position 100; Gln-100=LW(A) and Arg-100=LW(B). Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein, Transmembrane |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH300636 | ICAM4 MS Standard C13 and N15-labeled recombinant protein (NP_001034221) | 10 ug |
$3,255.00
|
|
LC411697 | ICAM4 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC419874 | ICAM4 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC422020 | ICAM4 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY411697 | Transient overexpression lysate of intercellular adhesion molecule 4 (Landsteiner-Wiener blood group) (ICAM4), transcript variant 2 | 100 ug |
$436.00
|
|
LY419874 | Transient overexpression lysate of intercellular adhesion molecule 4 (Landsteiner-Wiener blood group) (ICAM4), transcript variant 1 | 100 ug |
$436.00
|
|
LY422020 | Transient overexpression lysate of intercellular adhesion molecule 4 (Landsteiner-Wiener blood group) (ICAM4), transcript variant 3 | 100 ug |
$436.00
|
|
TP761371 | Purified recombinant protein of Human intercellular adhesion molecule 4 (Landsteiner-Wiener blood group) (ICAM4), transcript variant 1, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug | 50 ug |
$261.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.