FCGRT (NM_004107) Human Recombinant Protein
SKU
TP300364
Recombinant protein of human Fc fragment of IgG, receptor, transporter, alpha (FCGRT), transcript variant 1, 20 µg
$737.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC200364 representing NM_004107
Red=Cloning site Green=Tags(s) MGVPRPQPWALGLLLFLLPGSLGAESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEP CGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEF MNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKAR PSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHA GLAQPLRVELESPAKSSVLVVGIVIGVLLLTAAAVGGALLWRRMRSGLPAPWISLRGDDTGVLLPTPGEA QDADLKDVNVIPATA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 39.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Bioactivity | MS digestion standard (PMID: 27012525) MS digestion standard (PMID: 27232760) |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_004098 |
Locus ID | 2217 |
UniProt ID | P55899 |
Cytogenetics | 19q13.33 |
RefSeq Size | 1510 |
RefSeq ORF | 1095 |
Synonyms | alpha-chain; FCRN |
Summary | This gene encodes a receptor that binds the Fc region of monomeric immunoglobulin G. The encoded protein transfers immunoglobulin G antibodies from mother to fetus across the placenta. This protein also binds immunoglobulin G to protect the antibody from degradation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2009] |
Protein Families | Transmembrane |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH300364 | FCGRT MS Standard C13 and N15-labeled recombinant protein (NP_004098) | 10 ug |
$3,255.00
|
|
PH327329 | FCGRT MS Standard C13 and N15-labeled recombinant protein (NP_001129491) | 10 ug |
$3,255.00
|
|
LC401327 | FCGRT HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC427768 | FCGRT HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY401327 | Transient overexpression lysate of Fc fragment of IgG, receptor, transporter, alpha (FCGRT), transcript variant 2 | 100 ug |
$436.00
|
|
LY427768 | Transient overexpression lysate of Fc fragment of IgG, receptor, transporter, alpha (FCGRT), transcript variant 1 | 100 ug |
$436.00
|
|
TP327329 | Recombinant protein of human Fc fragment of IgG, receptor, transporter, alpha (FCGRT), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
TP721216 | Purified recombinant protein of Human Fc fragment of IgG, receptor, transporter, alpha (FCGRT), transcript variant 2 | 10 ug |
$265.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.