FCGRT (NM_004107) Human Recombinant Protein

CAT#: TP300364

Recombinant protein of human Fc fragment of IgG, receptor, transporter, alpha (FCGRT), transcript variant 1

Size: 20 ug 100 ug 1 mg



  View other "FCGRT" proteins (8)

USD 867.00

In Stock*

Size
    • 20 ug

Product Images

Frequently bought together (2)
Rabbit Polyclonal Anti-FCGRT Antibody
    • 100 ul

USD 539.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 412.00

Other products for "FCGRT"

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC200364 representing NM_004107
Red=Cloning site Green=Tags(s)

MGVPRPQPWALGLLLFLLPGSLGAESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEP
CGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEF
MNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKAR
PSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHA
GLAQPLRVELESPAKSSVLVVGIVIGVLLLTAAAVGGALLWRRMRSGLPAPWISLRGDDTGVLLPTPGEA
QDADLKDVNVIPATA

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 39.6 kDa
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Bioactivity MS digestion standard (PMID: 27012525)
MS digestion standard (PMID: 27232760)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Applications Cell culture: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_004098
Locus ID 2217
UniProt ID P55899, A0A024QZI2
Cytogenetics 19q13.33
Refseq Size 1510
Refseq ORF 1095
Synonyms alpha-chain; FCRN
Summary This gene encodes a receptor that binds the Fc region of monomeric immunoglobulin G. The encoded protein transfers immunoglobulin G antibodies from mother to fetus across the placenta. This protein also binds immunoglobulin G to protect the antibody from degradation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2009]
Protein Families Transmembrane

Documents

Other Versions

{0} Product Review(s)

0 Product Review(s)

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.