FCGRT Rabbit Polyclonal Antibody

SKU TA339394

Rabbit Polyclonal Anti-FCGRT Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FCGRT antibody: synthetic peptide directed towards the N terminal of human FCGRT. Synthetic peptide located within the following region: GWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 40 kDa
• Gene Name: Fc fragment of IgG receptor and transporter
• Database Link:
  NP_004098
  P55899
• Background: This gene encodes a receptor that binds the Fc region of monomeric immunoglobulin G. The encoded protein transfers immunoglobulin G antibodies from mother to fetus across the placenta. This protein also binds immunoglobulin G to protect the antibody from degradation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2009]
• Synonyms: alpha-chain; FCRN
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 86%; Guinea pig: 86%; Dog: 79%; Horse: 79%; Mouse: 79%; Sheep: 79%; Bovine: 79%

Reference Data

• Protein Families: Transmembrane