RAI3 (GPRC5A) (NM_003979) Human Recombinant Protein
SKU
TP300118
Recombinant protein of human G protein-coupled receptor, family C, group 5, member A (GPRC5A), 20 µg
$564.00
MSRP
$867.00
MSRP
$867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC200118 protein sequence
Red=Cloning site Green=Tags(s) MATTVPDGCRNGLKSKYYRLCDKAEAWGIVLETVATAGVVTSVAFMLTLPILVCKVQDSNRRKMLPTQFL FLLGVLGIFGLTFAFIIGLDGSTGPTRFFLFGILFSICFSCLLAHAVSLTKLVRGRKPLSLLVILGLAVG FSLVQDVIAIEYIVLTMNRTNVNVFSELSAPRRNEDFVLLLTYVLFLMALTFLMSSFTFCGSFTGWKRHG AHIYLTMLLSIAIWVAWITLLMLPDFDRRWDDTILSSALAANGWVFLLAYVSPEFWLLTKQRNPMDYPVE DAFCKPQLVKKSYGVENRAYSQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDY EVKKEGS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 40.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_003970 |
Locus ID | 9052 |
UniProt ID | Q8NFJ5 |
Cytogenetics | 12p13.1 |
RefSeq Size | 2856 |
RefSeq ORF | 1071 |
Synonyms | GPCR5A; PEIG-1; RAI3; RAIG1; TIG1 |
Summary | This gene encodes a member of the type 3 G protein-coupling receptor family, characterized by the signature 7-transmembrane domain motif. The encoded protein may be involved in interaction between retinoid acid and G protein signalling pathways. Retinoic acid plays a critical role in development, cellular growth, and differentiation. This gene may play a role in embryonic development and epithelial cell differentiation. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, GPCR, Transmembrane |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH300118 | GPRC5A MS Standard C13 and N15-labeled recombinant protein (NP_003970) | 10 ug |
$3,255.00
|
|
LC401304 | GPRC5A HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY401304 | Transient overexpression lysate of G protein-coupled receptor, family C, group 5, member A (GPRC5A) | 100 ug |
$436.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.