RAI3 (GPRC5A) (NM_003979) Human Recombinant Protein

CAT#: TP300118

Recombinant protein of human G protein-coupled receptor, family C, group 5, member A (GPRC5A), 20 µg

Product Images

Coomassie blue staining of purified GPRC5A protein (Cat# TP300118). The protein was produced from HEK293T cells transfected with GPRC5A cDNA clone (Cat# RC200118) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200118 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MATTVPDGCRNGLKSKYYRLCDKAEAWGIVLETVATAGVVTSVAFMLTLPILVCKVQDSNRRKMLPTQFL
  FLLGVLGIFGLTFAFIIGLDGSTGPTRFFLFGILFSICFSCLLAHAVSLTKLVRGRKPLSLLVILGLAVG
  FSLVQDVIAIEYIVLTMNRTNVNVFSELSAPRRNEDFVLLLTYVLFLMALTFLMSSFTFCGSFTGWKRHG
  AHIYLTMLLSIAIWVAWITLLMLPDFDRRWDDTILSSALAANGWVFLLAYVSPEFWLLTKQRNPMDYPVE
  DAFCKPQLVKKSYGVENRAYSQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDY
  EVKKEGS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 40.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_003970
• Locus ID: 9052
• UniProt ID: Q8NFJ5
• Cytogenetics: 12p13.1
• Refseq Size: 2856
• Refseq ORF: 1071
• Synonyms: GPCR5A; PEIG-1; RAI3; RAIG1; TIG1
• Summary: This gene encodes a member of the type 3 G protein-coupling receptor family, characterized by the signature 7-transmembrane domain motif. The encoded protein may be involved in interaction between retinoid acid and G protein signalling pathways. Retinoic acid plays a critical role in development, cellular growth, and differentiation. This gene may play a role in embryonic development and epithelial cell differentiation. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, GPCR, Transmembrane