RAI3 (GPRC5A) (NM_003979) Human Mass Spec Standard

SKU
PH300118
GPRC5A MS Standard C13 and N15-labeled recombinant protein (NP_003970)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200118]
Predicted MW 40.3 kDa
Protein Sequence
Protein Sequence
>RC200118 protein sequence
Red=Cloning site Green=Tags(s)

MATTVPDGCRNGLKSKYYRLCDKAEAWGIVLETVATAGVVTSVAFMLTLPILVCKVQDSNRRKMLPTQFL
FLLGVLGIFGLTFAFIIGLDGSTGPTRFFLFGILFSICFSCLLAHAVSLTKLVRGRKPLSLLVILGLAVG
FSLVQDVIAIEYIVLTMNRTNVNVFSELSAPRRNEDFVLLLTYVLFLMALTFLMSSFTFCGSFTGWKRHG
AHIYLTMLLSIAIWVAWITLLMLPDFDRRWDDTILSSALAANGWVFLLAYVSPEFWLLTKQRNPMDYPVE
DAFCKPQLVKKSYGVENRAYSQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDY
EVKKEGS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003970
RefSeq Size 2856
RefSeq ORF 1071
Synonyms GPCR5A; PEIG-1; RAI3; RAIG1; TIG1
Locus ID 9052
UniProt ID Q8NFJ5
Cytogenetics 12p13.1
Summary This gene encodes a member of the type 3 G protein-coupling receptor family, characterized by the signature 7-transmembrane domain motif. The encoded protein may be involved in interaction between retinoid acid and G protein signalling pathways. Retinoic acid plays a critical role in development, cellular growth, and differentiation. This gene may play a role in embryonic development and epithelial cell differentiation. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, GPCR, Transmembrane
Write Your Own Review
You're reviewing:RAI3 (GPRC5A) (NM_003979) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401304 GPRC5A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401304 Transient overexpression lysate of G protein-coupled receptor, family C, group 5, member A (GPRC5A) 100 ug
$436.00
TP300118 Recombinant protein of human G protein-coupled receptor, family C, group 5, member A (GPRC5A), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.