RAI3 (GPRC5A) Rabbit Polyclonal Antibody
Product Data | |
Application | WB |
---|---|
Recommended Dilution | WB |
Reactivity | Human |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-GPCR5A antibody: synthetic peptide directed towards the C terminal of human GPCR5A. Synthetic peptide located within the following region: SQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDY |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 39 kDa |
Gene Name | G protein-coupled receptor class C group 5 member A |
Database Link | |
Background | GPCR5A is a member of the type 3 G protein-coupling receptor family, characterized by the signature 7-transmembrane domain motif. The protein may be involved in interaction between retinoid acid and G protein signalling pathways. Retinoic acid plays a critical role in development, cellular growth, and differentiation. Its gene may play a role in embryonic development and epithelial cell differentiation.This gene encodes a member of the type 3 G protein-coupling receptor family, characterized by the signature 7-transmembrane domain motif. The encoded protein may be involved in interaction between retinoid acid and G protein signalling pathways. Retinoic acid plays a critical role in development, cellular growth, and differentiation. This gene may play a role in embryonic development and epithelial cell differentiation. |
Synonyms | GPCR5A; PEIG-1; RAI3; RAIG1; TIG1 |
Note | Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Mouse: 93%; Rabbit: 93%; Pig: 92%; Guinea pig: 91%; Horse: 85% |
Reference Data | |
Protein Families | Druggable Genome, GPCR, Transmembrane |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.