MRPL18 (NM_014161) Human Recombinant Protein

SKU TP300052

Recombinant protein of human mitochondrial ribosomal protein L18 (MRPL18), nuclear gene encoding mitochondrial protein, 20 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200052 protein sequence; Red=Cloning site Green=Tags(s); ; MALRSRFWGLFSVCRNPGCRFAALSTSSEPAAKPEVDPVENEAVAPEFTNRNPRNLELLSVARKERGWRT; VFPSREFWHRLRVIRTQHHVEALVEHQNGKVVVSASTREWAIKKHLYSTRNVVACESIGRVLAQRCLEAG; INFMVYQPTPWEAASDSMKRLQSAMTEGGVVLREPQRIYE; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 20.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_054880
• Locus ID: 29074
• UniProt ID: Q9H0U6
• Cytogenetics: 6q25.3
• RefSeq Size: 994
• RefSeq ORF: 540
• Synonyms: HSPC071; L18mt; MRP-L18
• Summary: This nuclear gene encodes a protein component of the larger 39S subunit of mitochondrial ribosome. This protein may also aid in the import of nuclear-encoded 5S rRNA into mitochondria. Alternative splicing results in multiple transcript variants, most of which are not predicted to encode a protein. A pseudogene of this gene is found on chromosome 16. [provided by RefSeq, Jan 2016]