MRPL18 (NM_014161) Human Mass Spec Standard

SKU PH300052

MRPL18 MS Standard C13 and N15-labeled recombinant protein (NP_054880)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC200052]
• Predicted MW: 20.6 kDa
• Protein Sequence:
  Protein Sequence

  >RC200052 protein sequence; Red=Cloning site Green=Tags(s); ; MALRSRFWGLFSVCRNPGCRFAALSTSSEPAAKPEVDPVENEAVAPEFTNRNPRNLELLSVARKERGWRT; VFPSREFWHRLRVIRTQHHVEALVEHQNGKVVVSASTREWAIKKHLYSTRNVVACESIGRVLAQRCLEAG; INFMVYQPTPWEAASDSMKRLQSAMTEGGVVLREPQRIYE; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_054880
• RefSeq Size: 994
• RefSeq ORF: 540
• Synonyms: HSPC071; L18mt; MRP-L18
• Locus ID: 29074
• UniProt ID: Q9H0U6
• Cytogenetics: 6q25.3
• Summary: This nuclear gene encodes a protein component of the larger 39S subunit of mitochondrial ribosome. This protein may also aid in the import of nuclear-encoded 5S rRNA into mitochondria. Alternative splicing results in multiple transcript variants, most of which are not predicted to encode a protein. A pseudogene of this gene is found on chromosome 16. [provided by RefSeq, Jan 2016]