TMEM208 (NM_014187) Human Recombinant Protein

SKU TP300049

Recombinant protein of human transmembrane protein 208 (TMEM208), 20 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200049 protein sequence; Red=Cloning site Green=Tags(s); ; MAPKGKVGTRGKKQIFEENRETLKFYLRIILGANAIYCLVTLVFFYSSASFWAWLALGFSLAVYGASYHS; MSSMARAAFSEDGALMDGGMDLNMEQGMAEHLKDVILLTAIVQVLSCFSLYVWSFWLLAPGRALYLLWVN; VLGPWFTADSGTPAPEHNEKRQRRQERRQMKRL; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 19.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_054906
• Locus ID: 29100
• UniProt ID: Q9BTX3
• Cytogenetics: 16q22.1
• RefSeq Size: 808
• RefSeq ORF: 519
• Synonyms: hSND2; HSPC171
• Summary: This gene encodes a highly conserved protein which is localized in the endoplasmic reticulum (ER). The protein is linked to autophagy and ER stress. Knockdown of this gene increased autophagy and triggered ER stress. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015]
• Protein Families: Transmembrane