TMEM208 (NM_014187) Human Mass Spec Standard

SKU
PH300049
TMEM208 MS Standard C13 and N15-labeled recombinant protein (NP_054906)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200049]
Predicted MW 19.6 kDa
Protein Sequence
Protein Sequence
>RC200049 protein sequence
Red=Cloning site Green=Tags(s)

MAPKGKVGTRGKKQIFEENRETLKFYLRIILGANAIYCLVTLVFFYSSASFWAWLALGFSLAVYGASYHS
MSSMARAAFSEDGALMDGGMDLNMEQGMAEHLKDVILLTAIVQVLSCFSLYVWSFWLLAPGRALYLLWVN
VLGPWFTADSGTPAPEHNEKRQRRQERRQMKRL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_054906
RefSeq Size 808
RefSeq ORF 519
Synonyms hSND2; HSPC171
Locus ID 29100
UniProt ID Q9BTX3
Cytogenetics 16q22.1
Summary This gene encodes a highly conserved protein which is localized in the endoplasmic reticulum (ER). The protein is linked to autophagy and ER stress. Knockdown of this gene increased autophagy and triggered ER stress. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:TMEM208 (NM_014187) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC415449 TMEM208 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415449 Transient overexpression lysate of transmembrane protein 208 (TMEM208) 100 ug
$436.00
TP300049 Recombinant protein of human transmembrane protein 208 (TMEM208), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.