C14orf166 (RTRAF) (NM_016039) Human Recombinant Protein
CAT#: TP300016
Recombinant protein of human chromosome 14 open reading frame 166 (C14orf166), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200016 protein sequence
Red=Cloning site Green=Tags(s) MFRRKLTALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLRDVNCP FKIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNSKTADNATKNAEPLINLDVNNPDFKAGVMALANL LQIQRHDDYLVMLKAIRILVQERLTQDAVAKANQTKEGLPVALDKHILGFDTGDAVLNEAAQILRLLHIE ELRELQTKINEAIVAVQAIIADPKTDHRLGKVGR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 27.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057123 |
Locus ID | 51637 |
UniProt ID | Q9Y224, Q549M8 |
Cytogenetics | 14q22.1 |
Refseq Size | 1064 |
Refseq ORF | 732 |
Synonyms | C14orf166; CGI-99; CGI99; CLE; CLE7; hCLE; hCLE1; LCRP369; RLLM1 |
Summary | RNA-binding protein involved in modulation of mRNA transcription by Polymerase II (PubMed:16950395). Component of the tRNA-splicing ligase complex and is required for tRNA ligation (PubMed:24870230). May be required for RNA transport (PubMed:24608264).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414235 | C14orf166 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY414235 | Transient overexpression lysate of chromosome 14 open reading frame 166 (C14orf166) |
USD 436.00 |
|
PH300016 | C14orf166 MS Standard C13 and N15-labeled recombinant protein (NP_057123) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review