C14orf166 (RTRAF) (NM_016039) Human Tagged ORF Clone

SKU
RC200016
C14orf166 (Myc-DDK-tagged)-Human chromosome 14 open reading frame 166 (C14orf166)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol C14orf166
Synonyms C14orf166; CGI-99; CGI99; CLE; CLE7; hCLE; hCLE1; LCRP369; RLLM1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200016 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTCCGACGCAAGTTGACGGCTCTCGACTACCACAACCCCGCCGGCTTCAACTGCAAAGATGAAACAG
AATTTAGAAACTTCATCGTTTGGCTTGAAGACCAGAAAATCAGGCACTACAAGATTGAAGACAGAGGGAA
TTTAAGAAACATCCACAGCAGCGACTGGCCCAAGTTCTTTGAAAAGTATCTCAGAGATGTTAACTGTCCT
TTCAAGATTCAAGATCGACAAGAAGCTATTGACTGGCTTCTTGGTTTAGCTGTTAGACTTGAATATGGAG
ATAATGCTGAAAAATACAAGGATTTAGTACCTGATAATTCAAAAACTGCTGACAATGCAACTAAAAATGC
AGAACCATTGATCAATTTGGATGTAAATAATCCTGATTTTAAGGCTGGTGTGATGGCTTTGGCTAACCTG
CTTCAGATTCAGCGTCATGATGATTACCTGGTAATGCTTAAGGCAATTCGGATTTTGGTTCAGGAGCGCC
TGACACAGGATGCAGTTGCTAAGGCAAATCAAACAAAAGAGGGCTTACCTGTTGCTTTAGACAAACATAT
TCTTGGTTTTGACACAGGAGATGCAGTTCTTAATGAAGCTGCTCAAATTCTGCGATTGCTGCACATAGAG
GAGCTCAGAGAGCTACAGACAAAAATCAACGAAGCCATAGTAGCTGTTCAGGCAATTATTGCTGATCCAA
AGACAGACCACAGACTGGGAAAAGTTGGAAGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200016 protein sequence
Red=Cloning site Green=Tags(s)

MFRRKLTALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLRDVNCP
FKIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNSKTADNATKNAEPLINLDVNNPDFKAGVMALANL
LQIQRHDDYLVMLKAIRILVQERLTQDAVAKANQTKEGLPVALDKHILGFDTGDAVLNEAAQILRLLHIE
ELRELQTKINEAIVAVQAIIADPKTDHRLGKVGR

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_016039
ORF Size 732 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_016039.3
RefSeq Size 1064 bp
RefSeq ORF 735 bp
Locus ID 51637
UniProt ID Q9Y224
Cytogenetics 14q22.1
MW 28.1 kDa
Summary RNA-binding protein involved in modulation of mRNA transcription by Polymerase II (PubMed:16950395). Component of the tRNA-splicing ligase complex and is required for tRNA ligation (PubMed:24870230). May be required for RNA transport (PubMed:24608264).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:C14orf166 (RTRAF) (NM_016039) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200016L1 Lenti ORF clone of Human chromosome 14 open reading frame 166 (C14orf166), Myc-DDK-tagged 10 ug
$600.00
RC200016L2 Lenti ORF clone of Human chromosome 14 open reading frame 166 (C14orf166), mGFP tagged 10 ug
$600.00
RC200016L3 Lenti ORF clone of Human chromosome 14 open reading frame 166 (C14orf166), Myc-DDK-tagged 10 ug
$600.00
RC200016L4 Lenti ORF clone of Human chromosome 14 open reading frame 166 (C14orf166), mGFP tagged 10 ug
$600.00
RG200016 C14orf166 (tGFP-tagged) - Human chromosome 14 open reading frame 166 (C14orf166) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC319441 C14orf166 (untagged)-Human chromosome 14 open reading frame 166 (C14orf166) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.