C14orf166 (RTRAF) (NM_016039) Human Mass Spec Standard

SKU
PH300016
C14orf166 MS Standard C13 and N15-labeled recombinant protein (NP_057123)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200016]
Predicted MW 28.1 kDa
Protein Sequence
Protein Sequence
>RC200016 protein sequence
Red=Cloning site Green=Tags(s)

MFRRKLTALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLRDVNCP
FKIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNSKTADNATKNAEPLINLDVNNPDFKAGVMALANL
LQIQRHDDYLVMLKAIRILVQERLTQDAVAKANQTKEGLPVALDKHILGFDTGDAVLNEAAQILRLLHIE
ELRELQTKINEAIVAVQAIIADPKTDHRLGKVGR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057123
RefSeq Size 1064
RefSeq ORF 732
Synonyms C14orf166; CGI-99; CGI99; CLE; CLE7; hCLE; hCLE1; LCRP369; RLLM1
Locus ID 51637
UniProt ID Q9Y224
Cytogenetics 14q22.1
Summary RNA-binding protein involved in modulation of mRNA transcription by Polymerase II (PubMed:16950395). Component of the tRNA-splicing ligase complex and is required for tRNA ligation (PubMed:24870230). May be required for RNA transport (PubMed:24608264).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:C14orf166 (RTRAF) (NM_016039) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC414235 C14orf166 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414235 Transient overexpression lysate of chromosome 14 open reading frame 166 (C14orf166) 100 ug
$436.00
TP300016 Recombinant protein of human chromosome 14 open reading frame 166 (C14orf166), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.