PPIL1 (NM_016059) Human Recombinant Protein

SKU TP300015

Recombinant protein of human peptidylprolyl isomerase (cyclophilin)-like 1 (PPIL1), 20 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200015 protein sequence; Red=Cloning site Green=Tags(s); ; MAAIPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGT; GRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVN; RVGMVETNSQDRPVDDVKIIKAYPSG; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 18.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_057143
• Locus ID: 51645
• UniProt ID: Q9Y3C6
• Cytogenetics: 6p21.2
• RefSeq Size: 1750
• RefSeq ORF: 498
• Synonyms: CGI-124; CYPL1; hCyPX; PCH14; PPIase
• Summary: This gene is a member of the cyclophilin family of peptidylprolyl isomerases (PPIases). The cyclophilins are a highly conserved, ubiquitous family, members of which play an important role in protein folding, immunosuppression by cyclosporin A, and infection of HIV-1 virions. Based on similarity to other PPIases, this protein could accelerate the folding of proteins and might catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. [provided by RefSeq, Jul 2008]
• Protein Pathways: Spliceosome