PPIL1 (NM_016059) Human Mass Spec Standard

SKU
PH300015
PPIL1 MS Standard C13 and N15-labeled recombinant protein (NP_057143)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200015]
Predicted MW 18.2 kDa
Protein Sequence
Protein Sequence
>RC200015 protein sequence
Red=Cloning site Green=Tags(s)

MAAIPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGT
GRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVN
RVGMVETNSQDRPVDDVKIIKAYPSG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057143
RefSeq Size 1750
RefSeq ORF 498
Synonyms CGI-124; CYPL1; hCyPX; PCH14; PPIase
Locus ID 51645
UniProt ID Q9Y3C6
Cytogenetics 6p21.2
Summary This gene is a member of the cyclophilin family of peptidylprolyl isomerases (PPIases). The cyclophilins are a highly conserved, ubiquitous family, members of which play an important role in protein folding, immunosuppression by cyclosporin A, and infection of HIV-1 virions. Based on similarity to other PPIases, this protein could accelerate the folding of proteins and might catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. [provided by RefSeq, Jul 2008]
Protein Pathways Spliceosome
Write Your Own Review
You're reviewing:PPIL1 (NM_016059) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC414224 PPIL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414224 Transient overexpression lysate of peptidylprolyl isomerase (cyclophilin)-like 1 (PPIL1) 100 ug
$436.00
TP300015 Recombinant protein of human peptidylprolyl isomerase (cyclophilin)-like 1 (PPIL1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720261 Recombinant protein of human peptidylprolyl isomerase (cyclophilin)-like 1 (PPIL1) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.