OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PPIL1 (NM_016059) Human Mass Spec Standard

Be the first to review this product
SKU
PH300015
PPIL1 MS Standard C13 and N15-labeled recombinant protein (NP_057143)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA803692 Purified PPIL1 mouse monoclonal antibody, clone OTI2D1 (formerly 2D1) 100 ul
$447.00
LY414224 Transient overexpression lysate of peptidylprolyl isomerase (cyclophilin)-like 1 (PPIL1) (as WB positive control) 100 ug
$436.00

Other products for "PPIL1 or NM_016059"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200015
Predicted MW 18.2 kDa
Protein Sequence
Protein Sequence
>RC200015 protein sequence
Red=Cloning site Green=Tags(s)

MAAIPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGT
GRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVN
RVGMVETNSQDRPVDDVKIIKAYPSG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057143
RefSeq Size 1750
RefSeq ORF 498
Synonyms CGI-124; CYPL1; hCyPX; PCH14; PPIase
Locus ID 51645
UniProt ID Q9Y3C6
Cytogenetics 6p21.2
Summary This gene is a member of the cyclophilin family of peptidylprolyl isomerases (PPIases). The cyclophilins are a highly conserved, ubiquitous family, members of which play an important role in protein folding, immunosuppression by cyclosporin A, and infection of HIV-1 virions. Based on similarity to other PPIases, this protein could accelerate the folding of proteins and might catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. provided by RefSeq, Jul 2008
Protein Pathways Spliceosome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PPIL1" proteins (4)
SKU Description Size Price
LC414224 Lyophilized PPIL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414224 Transient overexpression lysate of peptidylprolyl isomerase (cyclophilin)-like 1 (PPIL1) (as WB positive control) 100 ug
$436.00
TP300015 Recombinant protein of human peptidylprolyl isomerase (cyclophilin)-like 1 (PPIL1), 20 µg 20 ug
$867.00
TP720261 Recombinant protein of human peptidylprolyl isomerase (cyclophilin)-like 1 (PPIL1) 10 ug
$340.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products