Junctional Adhesion Molecule 1 (F11R) (NM_144504) Human Recombinant Protein

SKU
TP300004
Recombinant protein of human F11 receptor (F11R), transcript variant 5, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200004 protein sequence
Red=Cloning site Green=Tags(s)

MGTKAQVERKLLCLFILAILLCSLALGSVTVHSSEPEVRIPENNPVKLSCAYSGFSSPRVEWKFDQGDTT
RLVCYNNKITASYEDRVTFLPTGITFKSVTREDTGTYTCMVSEEGGNSYGEVKVKLIVLVPPSKPTVNIP
SSATIGNRAVLTCSEQDGSPPSEYTWFKDGIVMPTNPKSTRAFSNSSYVLNPTTGELVFDPLSASDTGEY
SCEARNGYGTPMTSNAVRMEAVERNVGVIVAAVLVTLILLGILVFGIWFAYSRGHFDRTKKGTSSKKVIY
SQPSARSEGEFKQTSSFLV

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 29.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_653087
Locus ID 50848
UniProt ID Q9Y624
Cytogenetics 1q23.3
RefSeq Size 3794
RefSeq ORF 897
Synonyms JAM, KAT, JAM1, JAMA, JCAM, CD321, JAM-1, JAM-A, PAM-1
Summary Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. The protein encoded by this immunoglobulin superfamily gene member is an important regulator of tight junction assembly in epithelia. In addition, the encoded protein can act as (1) a receptor for reovirus, (2) a ligand for the integrin LFA1, involved in leukocyte transmigration, and (3) a platelet receptor. Multiple 5' alternatively spliced variants, encoding the same protein, have been identified but their biological validity has not been established. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Transmembrane
Protein Pathways Cell adhesion molecules (CAMs), Epithelial cell signaling in Helicobacter pylori infection, Leukocyte transendothelial migration, Tight junction
Write Your Own Review
You're reviewing:Junctional Adhesion Molecule 1 (F11R) (NM_144504) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH300004 F11R MS Standard C13 and N15-labeled recombinant protein (NP_653087) 10 ug
$3,255.00
PH321478 F11R MS Standard C13 and N15-labeled recombinant protein (NP_058642) 10 ug
$3,255.00
LC403392 F11R HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC413796 F11R HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC429529 F11R HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403392 Transient overexpression lysate of F11 receptor (F11R), transcript variant 5 100 ug
$436.00
LY413796 Transient overexpression lysate of F11 receptor (F11R) 100 ug
$436.00
TP321478 Recombinant protein of human F11 receptor (F11R), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720393 Recombinant protein of human F11 receptor (F11R) 10 ug
$265.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.