Junctional Adhesion Molecule 1 (F11R) (NM_016946) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC221478] |
Predicted MW | 32.58 kDa |
Protein Sequence |
Protein Sequence
>RC221478 representing NM_016946
Red=Cloning site Green=Tags(s) MGTKAQVERKLLCLFILAILLCSLALGSVTVHSSEPEVRIPENNPVKLSCAYSGFSSPRVEWKFDQGDTT RLVCYNNKITASYEDRVTFLPTGITFKSVTREDTGTYTCMVSEEGGNSYGEVKVKLIVLVPPSKPTVNIP SSATIGNRAVLTCSEQDGSPPSEYTWFKDGIVMPTNPKSTRAFSNSSYVLNPTTGELVFDPLSASDTGEY SCEARNGYGTPMTSNAVRMEAVERNVGVIVAAVLVTLILLGILVFGIWFAYSRGHFDRTKKGTSSKKVIY SQPSARSEGEFKQTSSFLV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_058642 |
RefSeq Size | 3660 |
RefSeq ORF | 897 |
Synonyms | CD321; JAM; JAM1; JAMA; JCAM; KAT; PAM-1 |
Locus ID | 50848 |
UniProt ID | Q9Y624 |
Cytogenetics | 1q23.3 |
Summary | Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. The protein encoded by this immunoglobulin superfamily gene member is an important regulator of tight junction assembly in epithelia. In addition, the encoded protein can act as (1) a receptor for reovirus, (2) a ligand for the integrin LFA1, involved in leukocyte transmigration, and (3) a platelet receptor. Multiple 5' alternatively spliced variants, encoding the same protein, have been identified but their biological validity has not been established. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Cell adhesion molecules (CAMs), Epithelial cell signaling in Helicobacter pylori infection, Leukocyte transendothelial migration, Tight junction |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH300004 | F11R MS Standard C13 and N15-labeled recombinant protein (NP_653087) | 10 ug |
$3,255.00
|
|
LC403392 | F11R HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC413796 | F11R HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC429529 | F11R HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY403392 | Transient overexpression lysate of F11 receptor (F11R), transcript variant 5 | 100 ug |
$436.00
|
|
LY413796 | Transient overexpression lysate of F11 receptor (F11R) | 100 ug |
$436.00
|
|
TP300004 | Recombinant protein of human F11 receptor (F11R), transcript variant 5, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP321478 | Recombinant protein of human F11 receptor (F11R), 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP720393 | Recombinant protein of human F11 receptor (F11R) | 10 ug |
$265.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.