SSPN (NM_001135823) Human Mass Spec Standard

SKU
PH327888
SSPN MS Standard C13 and N15-labeled recombinant protein (NP_001129295)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC227888]
Predicted MW 26.62 kDa
Protein Sequence
Protein Sequence
>RC227888 representing NM_001135823
Red=Cloning site Green=Tags(s)

MGKNKQPRGQQRQGGPPAADAAGPDDMEPKKGTGAPKECGEEEPRTCCGCRFPLLLALLQLALGIAVTVV
GFLMASISSSLLVRDTPFWAGIIVCLVAYLGLFMLCVSYQVDERTCIQFSMKLLYFLLSALGLTVCVLAV
AFAAHHYSQLTQFTCETTLDSCQCKLPSSEPLSRTFVYRDVTDCTSVTGTFKLFLLIQMILNLVCGLVCL
LACFVMWKHRYQVFYVGVRICSLTASEGPQQKI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001129295
RefSeq ORF 729
Synonyms DAGA5; KRAG; NSPN; SPN1; SPN2
Locus ID 8082
UniProt ID Q14714
Cytogenetics 12p12.1
Summary This gene encodes a member of the dystrophin-glycoprotein complex (DGC). The DGC spans the sarcolemma and is comprised of dystrophin, syntrophin, alpha- and beta-dystroglycans and sarcoglycans. The DGC provides a structural link between the subsarcolemmal cytoskeleton and the extracellular matrix of muscle cells. Two alternatively spliced transcript variants that encode different protein isoforms have been described. [provided by RefSeq, Oct 2008]
Protein Families Druggable Genome, Transmembrane
Write Your Own Review
You're reviewing:SSPN (NM_001135823) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH309123 SSPN MS Standard C13 and N15-labeled recombinant protein (NP_005077) 10 ug
$3,255.00
LC417535 SSPN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY417535 Transient overexpression lysate of sarcospan (Kras oncogene-associated gene) (SSPN), transcript variant 1 100 ug
$436.00
TP309123 Recombinant protein of human sarcospan (Kras oncogene-associated gene) (SSPN), transcript variant 1, 20 µg 20 ug
$737.00
TP327888 Purified recombinant protein of Homo sapiens sarcospan (Kras oncogene-associated gene) (SSPN), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.