SSPN (NM_001135823) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC227888] |
Predicted MW | 26.62 kDa |
Protein Sequence |
Protein Sequence
>RC227888 representing NM_001135823
Red=Cloning site Green=Tags(s) MGKNKQPRGQQRQGGPPAADAAGPDDMEPKKGTGAPKECGEEEPRTCCGCRFPLLLALLQLALGIAVTVV GFLMASISSSLLVRDTPFWAGIIVCLVAYLGLFMLCVSYQVDERTCIQFSMKLLYFLLSALGLTVCVLAV AFAAHHYSQLTQFTCETTLDSCQCKLPSSEPLSRTFVYRDVTDCTSVTGTFKLFLLIQMILNLVCGLVCL LACFVMWKHRYQVFYVGVRICSLTASEGPQQKI myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001129295 |
RefSeq ORF | 729 |
Synonyms | DAGA5; KRAG; NSPN; SPN1; SPN2 |
Locus ID | 8082 |
UniProt ID | Q14714 |
Cytogenetics | 12p12.1 |
Summary | This gene encodes a member of the dystrophin-glycoprotein complex (DGC). The DGC spans the sarcolemma and is comprised of dystrophin, syntrophin, alpha- and beta-dystroglycans and sarcoglycans. The DGC provides a structural link between the subsarcolemmal cytoskeleton and the extracellular matrix of muscle cells. Two alternatively spliced transcript variants that encode different protein isoforms have been described. [provided by RefSeq, Oct 2008] |
Protein Families | Druggable Genome, Transmembrane |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH309123 | SSPN MS Standard C13 and N15-labeled recombinant protein (NP_005077) | 10 ug |
$3,255.00
|
|
LC417535 | SSPN HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY417535 | Transient overexpression lysate of sarcospan (Kras oncogene-associated gene) (SSPN), transcript variant 1 | 100 ug |
$436.00
|
|
TP309123 | Recombinant protein of human sarcospan (Kras oncogene-associated gene) (SSPN), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
TP327888 | Purified recombinant protein of Homo sapiens sarcospan (Kras oncogene-associated gene) (SSPN), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.