SSPN Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-SSPN antibody: synthetic peptide directed towards the middle region of human SSPN. Synthetic peptide located within the following region: AHHYSQLTQFTCETTLDSCQCKLPSSEPLSRTFVYRDVTDCTSVTGTFKL |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | lot specific |
| Purification | Protein A purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 26 kDa |
| Gene Name | sarcospan |
| Database Link | |
| Background | This gene encodes a member of the dystrophin-glycoprotein complex (DGC). The DGC spans the sarcolemma and is comprised of dystrophin, syntrophin, alpha- and beta-dystroglycans and sarcoglycans. The DGC provides a structural link between the subsarcolemmal cytoskeleton and the extracellular matrix of muscle cells. Two alternatively spliced transcript variants that encode different protein isoforms have been described. provided by RefSeq, Oct 2008 |
| Synonyms | DAGA5; KRAG; NSPN; SPN1; SPN2 |
| Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Mouse: 93%; Guinea pig: 93%; Horse: 79% |
| Reference Data | |
| Protein Categories | Membrane Proteins |
| Protein Families | Druggable Genome, Transmembrane |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
A novel canine model for Duchenne muscular dystrophy (DMD): single nucleotide deletion in DMD gene exon 20
Mata López, Hammond, Rigsby et al
Skelet Muscle (2018) 8 (1), 16 DOI: 10.1186/s13395-018-0162-1
Mata López, Hammond, Rigsby et al
Skelet Muscle (2018) 8 (1), 16 DOI: 10.1186/s13395-018-0162-1
AI Summary: OriGene’s sarcospan primary antibody was used to stain cryosections from the affected dog, enabling the researchers to assess sarcospan expression levels in the novel canine model of Duchenne muscular dystrophy.
Snippet: 3b, g, l). Cryosections from the affected dog stained for sarcospan with a primary antibody (Origene) at 1:250 and Alexa 488 goat anti-rabbit (Life Technologies) at 1:500 (Fig. 3c, g) showed increased expression, probably associated with utrophin upregulation [18] Cached
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
