Enkephalin (PENK) (NM_001135690) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC227805] |
Predicted MW | 30.8 kDa |
Protein Sequence |
Protein Sequence
>RC227805 protein sequence
Red=Cloning site Green=Tags(s) MARFLTLCTWLLLLGPGLLATVRAECSQDCATCSYRLVRPADINFLACVMECEGKLPSLKIWETCKELLQ LSKPELPQDGTSTLRENSKPEESHLLAKRYGGFMKRYGGFMKKMDELYPMEPEEEANGSEILAKRYGGFM KKDAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRGLKRSPQLEDEAKELQKRY GGFMRRVGRPEWWMDYQKRYGGFLKRFAEALPSDEEGESYSKEVPEMEKRYGGFMRF myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001129162 |
RefSeq Size | 1354 |
RefSeq ORF | 801 |
Synonyms | PE; PENK-A |
Locus ID | 5179 |
UniProt ID | P01210 |
Cytogenetics | 8q12.1 |
Summary | This gene encodes a preproprotein that is proteolytically processed to generate multiple protein products. These products include the pentapeptide opioids Met-enkephalin and Leu-enkephalin, which are stored in synaptic vesicles, then released into the synapse where they bind to mu- and delta-opioid receptors to modulate the perception of pain. Other non-opioid cleavage products may function in distinct biological activities. [provided by RefSeq, Jul 2015] |
Protein Families | Secreted Protein |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH307563 | PENK MS Standard C13 and N15-labeled recombinant protein (NP_006202) | 10 ug |
$3,255.00
|
|
LC401880 | PENK HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC427669 | PENK HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY401880 | Transient overexpression lysate of proenkephalin (PENK), transcript variant 2 | 100 ug |
$436.00
|
|
LY427669 | Transient overexpression lysate of proenkephalin (PENK), transcript variant 1 | 100 ug |
$436.00
|
|
TP307563 | Recombinant protein of human proenkephalin (PENK), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
TP327805 | Recombinant protein of human proenkephalin (PENK), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.