Enkephalin (PENK) (NM_006211) Human Mass Spec Standard

SKU
PH307563
PENK MS Standard C13 and N15-labeled recombinant protein (NP_006202)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC207563]
Predicted MW 30.8 kDa
Protein Sequence
Protein Sequence
>RC207563 protein sequence
Red=Cloning site Green=Tags(s)

MARFLTLCTWLLLLGPGLLATVRAECSQDCATCSYRLVRPADINFLACVMECEGKLPSLKIWETCKELLQ
LSKPELPQDGTSTLRENSKPEESHLLAKRYGGFMKRYGGFMKKMDELYPMEPEEEANGSEILAKRYGGFM
KKDAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRGLKRSPQLEDEAKELQKRY
GGFMRRVGRPEWWMDYQKRYGGFLKRFAEALPSDEEGESYSKEVPEMEKRYGGFMRF

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006202
RefSeq Size 1221
RefSeq ORF 801
Synonyms enkephalin A; preproenkephalin; proenkephalin
Locus ID 5179
UniProt ID P01210
Cytogenetics 8q12.1
Summary This gene encodes a preproprotein that is proteolytically processed to generate multiple protein products. These products include the pentapeptide opioids Met-enkephalin and Leu-enkephalin, which are stored in synaptic vesicles, then released into the synapse where they bind to mu- and delta-opioid receptors to modulate the perception of pain. Other non-opioid cleavage products may function in distinct biological activities. [provided by RefSeq, Jul 2015]
Protein Families Secreted Protein
Write Your Own Review
You're reviewing:Enkephalin (PENK) (NM_006211) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH327805 PENK MS Standard C13 and N15-labeled recombinant protein (NP_001129162) 10 ug
$3,255.00
LC401880 PENK HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427669 PENK HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401880 Transient overexpression lysate of proenkephalin (PENK), transcript variant 2 100 ug
$436.00
LY427669 Transient overexpression lysate of proenkephalin (PENK), transcript variant 1 100 ug
$436.00
TP307563 Recombinant protein of human proenkephalin (PENK), transcript variant 2, 20 µg 20 ug
$737.00
TP327805 Recombinant protein of human proenkephalin (PENK), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.