DSN1 (NM_001145316) Human Mass Spec Standard

SKU
PH326614
DSN1 MS Standard C13 and N15-labeled recombinant protein (NP_001138788)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC226614]
Predicted MW 39.9 kDa
Protein Sequence
Protein Sequence
>RC226614 representing NM_001145316
Red=Cloning site Green=Tags(s)

MTSVTRSEIIDEKGPVMSKTHDHQLESSLSPVEVFAKTSASLEMNQGVSEERIHLGSSPKKGGNCDLSHQ
ERLQSKSLHLSPQEQSASYQDRRQSWRRASMKETNRRKSLHPIHQGITELSRSISVDLAESKRLGCLLLS
SFQFSIQKLEPFLRDTKGFSLESFRAKASSLSEELKHFADGLETDGTLQKCFEDSNGKASDFSLEASVAE
MKEYITKFSLERQTWDQLLLHYQQEAKEILSRGSTEAKITEVKVEPMTYLGSSQNEVLNTKPDYQKILQN
QSKVFDCMELVMDELQGSVKQLQAFMDESTQCFQKVSVQLGKRSMQQLDPSPARKLLKLQLQNPPAIHGS
GSGSCQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001138788
RefSeq ORF 1068
Synonyms C20orf172; dJ469A13.2; hKNL-3; KNL3; MIS13
Locus ID 79980
UniProt ID Q9H410
Cytogenetics 20q11.23
Summary This gene encodes a kinetochore protein that functions as part of the minichromosome instability-12 centromere complex. The encoded protein is required for proper kinetochore assembly and progression through the cell cycle. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2009]
Write Your Own Review
You're reviewing:DSN1 (NM_001145316) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH316609 DSN1 MS Standard C13 and N15-labeled recombinant protein (NP_079194) 10 ug
$3,255.00
PH326656 DSN1 MS Standard C13 and N15-labeled recombinant protein (NP_001138790) 10 ug
$3,255.00
LC411014 DSN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428819 DSN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428821 DSN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411014 Transient overexpression lysate of DSN1, MIND kinetochore complex component, homolog (S. cerevisiae) (DSN1), transcript variant 3 100 ug
$436.00
LY428819 Transient overexpression lysate of DSN1, MIND kinetochore complex component, homolog (S. cerevisiae) (DSN1), transcript variant 1 100 ug
$436.00
LY428821 Transient overexpression lysate of DSN1, MIND kinetochore complex component, homolog (S. cerevisiae) (DSN1), transcript variant 5 100 ug
$436.00
TP316609 Recombinant protein of human DSN1, MIND kinetochore complex component, homolog (S. cerevisiae) (DSN1), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP326614 Recombinant protein of human DSN1, MIND kinetochore complex component, homolog (S. cerevisiae) (DSN1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP326656 Purified recombinant protein of Homo sapiens DSN1, MIND kinetochore complex component, homolog (S. cerevisiae) (DSN1), transcript variant 5, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.