DSN1 Rabbit Polyclonal Antibody

SKU
TA338299
Rabbit Polyclonal Anti-DSN1 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-DSN1 antibody is: synthetic peptide directed towards the N-terminal region of Human DSN1. Synthetic peptide located within the following region: SKSLHLSPQEQSASYQDRRQSWRRASMKETNRRKSLHPIHQGITELSRSI
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 38 kDa
Gene Name DSN1 homolog, MIS12 kinetochore complex component
Database Link
Background This gene encodes a kinetochore protein that functions as part of the minichromosome instability-12 centromere complex. The encoded protein is required for proper kinetochore assembly and progression through the cell cycle. Alternative splicing results in multiple transcript variants.
Synonyms C20orf172; dJ469A13.2; hKNL-3; KNL3; MIS13
Note Immunogen Sequence Homology: Human: 100%; Pig: 86%; Horse: 86%; Rat: 79%
Reference Data
Write Your Own Review
You're reviewing:DSN1 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.