DSN1 Rabbit Polyclonal Antibody

SKU TA338299

Rabbit Polyclonal Anti-DSN1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DSN1 antibody is: synthetic peptide directed towards the N-terminal region of Human DSN1. Synthetic peptide located within the following region: SKSLHLSPQEQSASYQDRRQSWRRASMKETNRRKSLHPIHQGITELSRSI
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 38 kDa
• Gene Name: DSN1 homolog, MIS12 kinetochore complex component
• Database Link:
  NP_001138790
  Q9H410
• Background: This gene encodes a kinetochore protein that functions as part of the minichromosome instability-12 centromere complex. The encoded protein is required for proper kinetochore assembly and progression through the cell cycle. Alternative splicing results in multiple transcript variants.
• Synonyms: C20orf172; dJ469A13.2; hKNL-3; KNL3; MIS13
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 86%; Horse: 86%; Rat: 79%

Reference Data