ECE1 (NM_001113349) Human Mass Spec Standard

SKU
PH326153
ECE1 MS Standard C13 and N15-labeled recombinant protein (NP_001106820)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC226153]
Predicted MW 86.8 kDa
Protein Sequence
Protein Sequence
>RC226153 representing NM_001113349
Red=Cloning site Green=Tags(s)

MEALRESVLHLALQMSTYKRATLDEEDLVDSLSEGDAYPNGLQVNFHSPRSGQRCWAARTQVEKRLVVLV
VLLAAGLVACLAALGIQYQTRSPSVCLSEACVSVTSSILSSMDPTVDPCHDFFSYACGGWIKANPVPDGH
SRWGTFSNLWEHNQAIIKHLLENSTASVSEAERKAQVYYRACMNETRIEELRAKPLMELIERLGGWNITG
PWAKDNFQDTLQVVTAHYRTSPFFSVYVSADSKNSNSNVIQVDQSGLGLPSRDYYLNKTENEKVLTGYLN
YMVQLGKLLGGGDEEAIRPQMQQILDFETALANITIPQEKRRDEELIYHKVTAAELQTLAPAINWLPFLN
TIFYPVEINESEPIVVYDKEYLEQISTLINTTDRCLLNNYMIWNLVRKTSSFLDQRFQDADEKFMEVMYG
TKKTCLPRWKFCVSDTENNLGFALGPMFVKATFAEDSKSIATEIILEIKKAFEESLSTLKWMDEETRKSA
KEKADAIYNMIGYPNFIMDPKELDKVFNDYTAVPDLYFENAMRFFNFSWRVTADQLRKAPNRDQWSMTPP
MVNAYYSPTKNEIVFPAGILQAPFYTRSSPKALNFGGIGVVVGHELTHAFDDQGREYDKDGNLRPWWKNS
SVEAFKRQTECMVEQYSNYSVNGEPVNGRHTLGENIADNGGLKAAYRAYQNWVKKNGAEHSLPTLGLTNN
QLFFLGFAQVWCSVRTPESSHEGLITDPHSPSRFRVIGSLSNSKEFSEHFRCPPGSPMNPPHKCEVW

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001106820
RefSeq ORF 2301
Synonyms ECE
Locus ID 1889
UniProt ID P42892
Cytogenetics 1p36.12
Summary The protein encoded by this gene is involved in proteolytic processing of endothelin precursors to biologically active peptides. Mutations in this gene are associated with Hirschsprung disease, cardiac defects and autonomic dysfunction. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.[provided by RefSeq, Sep 2009]
Protein Families Druggable Genome, Protease, Transmembrane
Write Your Own Review
You're reviewing:ECE1 (NM_001113349) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH323135 ECE1 MS Standard C13 and N15-labeled recombinant protein (NP_001388) 10 ug
$3,255.00
LC419958 ECE1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426400 ECE1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419958 Transient overexpression lysate of endothelin converting enzyme 1 (ECE1), transcript variant 1 100 ug
$665.00
LY426400 Transient overexpression lysate of endothelin converting enzyme 1 (ECE1), transcript variant 2 100 ug
$665.00
TP323135 Purified recombinant protein of Homo sapiens endothelin converting enzyme 1 (ECE1), transcript variant 1, 20 µg 20 ug
$737.00
TP326153 Recombinant protein of human endothelin converting enzyme 1 (ECE1), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.