OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ECE1 (NM_001397) Human Mass Spec Standard

Be the first to review this product
SKU
PH323135
ECE1 MS Standard C13 and N15-labeled recombinant protein (NP_001388)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA804823 ECE1 mouse monoclonal antibody, clone OTI2B6 (formerly 2B6) 100 ul
$447.00
LY419958 Transient overexpression lysate of endothelin converting enzyme 1 (ECE1), transcript variant 1 (as WB positive control) 100 ug
$665.00

Other products for "ECE1 or NM_001397"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC223135
Predicted MW 87 kDa
Protein Sequence
Protein Sequence
>RC223135 representing NM_001397
Red=Cloning site Green=Tags(s)

MRGVWPPPVSALLSALGMSTYKRATLDEEDLVDSLSEGDAYPNGLQVNFHSPRSGQRCWAARTQVEKRLV
VLVVLLAAGLVACLAALGIQYQTRSPSVCLSEACVSVTSSILSSMDPTVDPCHDFFSYACGGWIKANPVP
DGHSRWGTFSNLWEHNQAIIKHLLENSTASVSEAERKAQVYYRACMNETRIEELRAKPLMELIERLGGWN
ITGPWAKDNFQDTLQVVTAHYRTSPFFSVYVSADSKNSNSNVIQVDQSGLGLPSRDYYLNKTENEKVLTG
YLNYMVQLGKLLGGGDEEAIRPQMQQILDFETALANITIPQEKRRDEELIYHKVTAAELQTLAPAINWLP
FLNTIFYPVEINESEPIVVYDKEYLEQISTLINTTDRCLLNNYMIWNLVRKTSSFLDQRFQDADEKFMEV
MYGTKKTCLPRWKFCVSDTENNLGFALGPMFVKATFAEDSKSIATEIILEIKKAFEESLSTLKWMDEETR
KSAKEKADAIYNMIGYPNFIMDPKELDKVFNDYTAVPDLYFENAMRFFNFSWRVTADQLRKAPNRDQWSM
TPPMVNAYYSPTKNEIVFPAGILQAPFYTRSSPKALNFGGIGVVVGHELTHAFDDQGREYDKDGNLRPWW
KNSSVEAFKRQTECMVEQYSNYSVNGEPVNGRHTLGENIADNGGLKAAYRAYQNWVKKNGAEHSLPTLGL
TNNQLFFLGFAQVWCSVRTPESSHEGLITDPHSPSRFRVIGSLSNSKEFSEHFRCPPGSPMNPPHKCEVW

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001388
RefSeq Size 2409
RefSeq ORF 2310
Synonyms ECE
Locus ID 1889
UniProt ID P42892
Cytogenetics 1p36.12
Summary The protein encoded by this gene is involved in proteolytic processing of endothelin precursors to biologically active peptides. Mutations in this gene are associated with Hirschsprung disease, cardiac defects and autonomic dysfunction. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.provided by RefSeq, Sep 2009
Protein Families Druggable Genome, Protease, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ECE1" proteins (7)
SKU Description Size Price
PH326153 ECE1 MS Standard C13 and N15-labeled recombinant protein (NP_001106820) 10 ug
$3,360.00
LC419958 Lyophilized ECE1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426400 Lyophilized ECE1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419958 Transient overexpression lysate of endothelin converting enzyme 1 (ECE1), transcript variant 1 (as WB positive control) 100 ug
$665.00
LY426400 Transient overexpression lysate of endothelin converting enzyme 1 (ECE1), transcript variant 2 (as WB positive control) 100 ug
$665.00
TP323135 Purified recombinant protein of Homo sapiens endothelin converting enzyme 1 (ECE1), transcript variant 1, 20 µg 20 ug
$737.00
TP326153 Recombinant protein of human endothelin converting enzyme 1 (ECE1), transcript variant 2, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products