YAP1 (NM_001130145) Human Mass Spec Standard

SKU
PH325864
YAP1 MS Standard C13 and N15-labeled recombinant protein (NP_001123617)
$3,255.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC225864]
Predicted MW 54.3 kDa
Protein Sequence
Protein Sequence
>RC225864 representing NM_001130145
Red=Cloning site Green=Tags(s)

MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFN
AVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPG
TLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQM
NVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVK
QPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRS
QLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSV
DEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVL
AATKLDKESFLTWL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001123617
RefSeq ORF 1512
Synonyms COB1; YAP; YAP2; YAP65; YKI
Locus ID 10413
UniProt ID P46937
Cytogenetics 11q22.1
Summary This gene encodes a downstream nuclear effector of the Hippo signaling pathway which is involved in development, growth, repair, and homeostasis. This gene is known to play a role in the development and progression of multiple cancers as a transcriptional regulator of this signaling pathway and may function as a potential target for cancer treatment. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Aug 2013]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:YAP1 (NM_001130145) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401842 YAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC434268 YAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401842 Transient overexpression lysate of Yes-associated protein 1, 65kDa (YAP1), transcript variant 2 100 ug
$665.00
LY434268 Transient overexpression lysate of Yes-associated protein 1 (YAP1), transcript variant 3 100 ug
$436.00
TP325864 Purified recombinant protein of Homo sapiens Yes-associated protein 1, 65kDa (YAP1), transcript variant 1, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.