SIGIRR (NM_001135053) Human Mass Spec Standard

SKU
PH325642
SIGIRR MS Standard C13 and N15-labeled recombinant protein (NP_001128525)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC225642]
Predicted MW 45.7 kDa
Protein Sequence
Protein Sequence
>RC225642 protein sequence
Red=Cloning site Green=Tags(s)

MPGVCDRAPDFLSPSEDQVLRPALGSSVALNCTAWVVSGPHCSLPSVQWLKDGLPLGIGGHYSLHEYSWV
KANLSEVLVSSVLGVNVTSTEVYGAFTCSIQNISFSSFTLQRAGPTSHVAAVLASLLVLLALLLAALLYV
KCRLNVLLWYQDAYGEVEINDGKLYDAYVSYSDCPEDRKFVNFILKPQLERRRGYKLFLDDRDLLPRAEP
SADLLVNLSRCRRLIVVLSDAFLSRAWCSHSFREGLCRLLELTRRPIFITFEGQRRDPAHPALRLLRQHR
HLVTLLLWRPGSVTPSSDFWKEVQLALPRKVRYRPVEGDPQTQLQDDKDPMLILRGRVPEGRALDSEVDP
DPEGDLGVRGPVFGEPSAPPHTSGVSLGESRSSEVDVSDLGSRNYSARTDFYCLVSKDDM

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001128525
RefSeq Size 1688
RefSeq ORF 1230
Synonyms IL-1R8; TIR8
Locus ID 59307
UniProt ID Q6IA17
Cytogenetics 11p15.5
Summary Acts as a negative regulator of the Toll-like and IL-1R receptor signaling pathways. Attenuates the recruitment of receptor-proximal signaling components to the TLR4 receptor, probably through an TIR-TIR domain interaction with TLR4. Through its extracellular domain interferes with the heterodimerization of Il1R1 and IL1RAP.[UniProtKB/Swiss-Prot Function]
Protein Families Transcription Factors, Transmembrane
Write Your Own Review
You're reviewing:SIGIRR (NM_001135053) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH301356 SIGIRR MS Standard C13 and N15-labeled recombinant protein (NP_068577) 10 ug
$3,255.00
PH325643 SIGIRR MS Standard C13 and N15-labeled recombinant protein (NP_001128526) 10 ug
$3,255.00
LC402876 SIGIRR HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427540 SIGIRR HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427541 SIGIRR HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402876 Transient overexpression lysate of single immunoglobulin and toll-interleukin 1 receptor (TIR) domain (SIGIRR), transcript variant 3 100 ug
$436.00
LY427540 Transient overexpression lysate of single immunoglobulin and toll-interleukin 1 receptor (TIR) domain (SIGIRR), transcript variant 2 100 ug
$436.00
LY427541 Transient overexpression lysate of single immunoglobulin and toll-interleukin 1 receptor (TIR) domain (SIGIRR), transcript variant 1 100 ug
$436.00
TP301356 Purified recombinant protein of Homo sapiens single immunoglobulin and toll-interleukin 1 receptor (TIR) domain (SIGIRR), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP325642 Recombinant protein of human single immunoglobulin and toll-interleukin 1 receptor (TIR) domain (SIGIRR), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP325643 Recombinant protein of human single immunoglobulin and toll-interleukin 1 receptor (TIR) domain (SIGIRR), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP762571 Purified recombinant protein of Human single immunoglobulin and toll-interleukin 1 receptor (TIR) domain (SIGIRR), transcript variant 3, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.