NAPE PLD (NAPEPLD) (NM_001122838) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC225603] |
Predicted MW | 45.4 kDa |
Protein Sequence |
Protein Sequence
>RC225603 representing NM_001122838
Red=Cloning site Green=Tags(s) MDENESNQSLMTSSQYPKEAVRKRQNSARNSGASDSSRFSRKSFKLDYRLEEDVTKSKKGKDGRFVNPWP TWKNPSIPNVLRWLIMEKDHSSVPSSKEELDKELPVLKPYFITNPEEAGVREAGLRVTWLGHATVMVEMD ELIFLTDPIFSSRASPSQYMGPKRFRRSPCTISELPPIDAVLISHNHYDHLDYNSVIALNERFGNELRWF VPLGLLDWMQKCGCENVIELDWWEENCVPGHDKVTFVFTPSQHWCKRTLMDDNKVLWGSWSVLGPWNRFF FAGDTGYCPAFEEIGKRFGPFDLAAIPIGAYEPRWFMKYQHVDPEEAVRIHTDVQTKKSMAIHWGTFALA NEHYLEPPVKLNEALERYGLNAEDFFVLKHGESRYLNNDDENF myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001116310 |
RefSeq ORF | 1179 |
Synonyms | C7orf18; FMP30; NAPE-PLD |
Locus ID | 222236 |
UniProt ID | Q6IQ20 |
Cytogenetics | 7q22.1 |
Summary | NAPEPLD is a phospholipase D type enzyme that catalyzes the release of N-acylethanolamine (NAE) from N-acyl-phosphatidylethanolamine (NAPE) in the second step of the biosynthesis of N-acylethanolamine (Okamoto et al., 2004 [PubMed 14634025]).[supplied by OMIM, Oct 2008] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH309877 | NAPEPLD MS Standard C13 and N15-labeled recombinant protein (NP_945341) | 10 ug |
$3,255.00
|
|
LC404703 | NAPEPLD HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC426574 | NAPEPLD HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY404703 | Transient overexpression lysate of N-acyl phosphatidylethanolamine phospholipase D (NAPEPLD), transcript variant 2 | 100 ug |
$436.00
|
|
LY426574 | Transient overexpression lysate of N-acyl phosphatidylethanolamine phospholipase D (NAPEPLD), transcript variant 1 | 100 ug |
$436.00
|
|
TP309877 | Recombinant protein of human N-acyl phosphatidylethanolamine phospholipase D (NAPEPLD), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
TP325603 | Recombinant protein of human N-acyl phosphatidylethanolamine phospholipase D (NAPEPLD), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.