NAPE PLD (NAPEPLD) (NM_198990) Human Mass Spec Standard

SKU
PH309877
NAPEPLD MS Standard C13 and N15-labeled recombinant protein (NP_945341)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC209877]
Predicted MW 45.6 kDa
Protein Sequence
Protein Sequence
>RC209877 protein sequence
Red=Cloning site Green=Tags(s)

MDENESNQSLMTSSQYPKEAVRKRQNSARNSGASDSSRFSRKSFKLDYRLEEDVTKSKKGKDGRFVNPWP
TWKNPSIPNVLRWLIMEKDHSSVPSSKEELDKELPVLKPYFITNPEEAGVREAGLRVTWLGHATVMVEMD
ELIFLTDPIFSSRASPSQYMGPKRFRRSPCTISELPPIDAVLISHNHYDHLDYNSVIALNERFGNELRWF
VPLGLLDWMQKCGCENVIELDWWEENCVPGHDKVTFVFTPSQHWCKRTLMDDNKVLWGSWSVLGPWNRFF
FAGDTGYCPAFEEIGKRFGPFDLAAIPIGAYEPRWFMKYQHVDPEEAVRIHTDVQTKKSMAIHWGTFALA
NEHYLEPPVKLNEALERYGLNAEDFFVLKHGESRYLNNNDENF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_945341
RefSeq Size 5062
RefSeq ORF 1179
Synonyms C7orf18; FMP30; NAPE-PLD
Locus ID 222236
UniProt ID Q6IQ20
Cytogenetics 7q22.1
Summary NAPEPLD is a phospholipase D type enzyme that catalyzes the release of N-acylethanolamine (NAE) from N-acyl-phosphatidylethanolamine (NAPE) in the second step of the biosynthesis of N-acylethanolamine (Okamoto et al., 2004 [PubMed 14634025]).[supplied by OMIM, Oct 2008]
Write Your Own Review
You're reviewing:NAPE PLD (NAPEPLD) (NM_198990) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH325603 NAPEPLD MS Standard C13 and N15-labeled recombinant protein (NP_001116310) 10 ug
$3,255.00
LC404703 NAPEPLD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426574 NAPEPLD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY404703 Transient overexpression lysate of N-acyl phosphatidylethanolamine phospholipase D (NAPEPLD), transcript variant 2 100 ug
$436.00
LY426574 Transient overexpression lysate of N-acyl phosphatidylethanolamine phospholipase D (NAPEPLD), transcript variant 1 100 ug
$436.00
TP309877 Recombinant protein of human N-acyl phosphatidylethanolamine phospholipase D (NAPEPLD), transcript variant 2, 20 µg 20 ug
$737.00
TP325603 Recombinant protein of human N-acyl phosphatidylethanolamine phospholipase D (NAPEPLD), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.