Activin A Receptor Type IC (ACVR1C) (NM_001111033) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC225494] |
Predicted MW | 37.3 kDa |
Protein Sequence |
Protein Sequence
>RC225494 representing NM_001111033
Red=Cloning site Green=Tags(s) MTRALCSALRQALLLLAAAAELSPGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELN AQVFCHSSNNVTKTECCFTDFCNNITLHLPTDNGTWTQLWLVSEYHEQGSLYDYLNRNIVTVAGMIKLAL SIASGLAHLHMEIVGTQGKPAIAHRDIKSKNILVKKCETCAIADLGLAVKHDSILNTIDIPQNPKVGTKR YMAPEMLDDTMNVNIFESFKRADIYSVGLVYWEIARRCSVGGIVEEYQLPYYDMVPSDPSIEEMRKVVCD QKFRPSIPNQWQSCEALRVMGRIMRECWYANGAARLTALRIKKTISQLCVKEDCKA myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001104503 |
RefSeq ORF | 1008 |
Synonyms | ACVRLK7; ALK7 |
Locus ID | 130399 |
UniProt ID | Q8NER5 |
Cytogenetics | 2q24.1 |
Summary | ACVR1C is a type I receptor for the TGFB (see MIM 190180) family of signaling molecules. Upon ligand binding, type I receptors phosphorylate cytoplasmic SMAD transcription factors, which then translocate to the nucleus and interact directly with DNA or in complex with other transcription factors (Bondestam et al., 2001 [PubMed 12063393]).[supplied by OMIM, Mar 2008] |
Protein Families | Druggable Genome, Protein Kinase, Transmembrane |
Protein Pathways | Adherens junction, Chronic myeloid leukemia, Colorectal cancer, Endocytosis, MAPK signaling pathway, Pancreatic cancer, Pathways in cancer, TGF-beta signaling pathway |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC403426 | ACVR1C HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC426337 | ACVR1C HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC426339 | ACVR1C HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY403426 | Transient overexpression lysate of activin A receptor, type IC (ACVR1C), transcript variant 1 | 100 ug |
$436.00
|
|
LY426337 | Transient overexpression lysate of activin A receptor, type IC (ACVR1C), transcript variant 2 | 100 ug |
$436.00
|
|
LY426339 | Transient overexpression lysate of activin A receptor, type IC (ACVR1C), transcript variant 4 | 100 ug |
$436.00
|
|
TP325494 | Purified recombinant protein of Homo sapiens activin A receptor, type IC (ACVR1C), transcript variant 4, 20 µg | 20 ug |
$867.00
|
|
TP761292 | Purified recombinant protein of Human activin A receptor, type IC (ACVR1C), transcript variant 1, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug | 50 ug |
$261.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.