Activin A Receptor Type IC (ACVR1C) (NM_001111033) Human Mass Spec Standard

SKU
PH325494
ACVR1C MS Standard C13 and N15-labeled recombinant protein (NP_001104503)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC225494]
Predicted MW 37.3 kDa
Protein Sequence
Protein Sequence
>RC225494 representing NM_001111033
Red=Cloning site Green=Tags(s)

MTRALCSALRQALLLLAAAAELSPGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELN
AQVFCHSSNNVTKTECCFTDFCNNITLHLPTDNGTWTQLWLVSEYHEQGSLYDYLNRNIVTVAGMIKLAL
SIASGLAHLHMEIVGTQGKPAIAHRDIKSKNILVKKCETCAIADLGLAVKHDSILNTIDIPQNPKVGTKR
YMAPEMLDDTMNVNIFESFKRADIYSVGLVYWEIARRCSVGGIVEEYQLPYYDMVPSDPSIEEMRKVVCD
QKFRPSIPNQWQSCEALRVMGRIMRECWYANGAARLTALRIKKTISQLCVKEDCKA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001104503
RefSeq ORF 1008
Synonyms ACVRLK7; ALK7
Locus ID 130399
UniProt ID Q8NER5
Cytogenetics 2q24.1
Summary ACVR1C is a type I receptor for the TGFB (see MIM 190180) family of signaling molecules. Upon ligand binding, type I receptors phosphorylate cytoplasmic SMAD transcription factors, which then translocate to the nucleus and interact directly with DNA or in complex with other transcription factors (Bondestam et al., 2001 [PubMed 12063393]).[supplied by OMIM, Mar 2008]
Protein Families Druggable Genome, Protein Kinase, Transmembrane
Protein Pathways Adherens junction, Chronic myeloid leukemia, Colorectal cancer, Endocytosis, MAPK signaling pathway, Pancreatic cancer, Pathways in cancer, TGF-beta signaling pathway
Write Your Own Review
You're reviewing:Activin A Receptor Type IC (ACVR1C) (NM_001111033) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC403426 ACVR1C HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426337 ACVR1C HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426339 ACVR1C HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403426 Transient overexpression lysate of activin A receptor, type IC (ACVR1C), transcript variant 1 100 ug
$436.00
LY426337 Transient overexpression lysate of activin A receptor, type IC (ACVR1C), transcript variant 2 100 ug
$436.00
LY426339 Transient overexpression lysate of activin A receptor, type IC (ACVR1C), transcript variant 4 100 ug
$436.00
TP325494 Purified recombinant protein of Homo sapiens activin A receptor, type IC (ACVR1C), transcript variant 4, 20 µg 20 ug
$867.00
TP761292 Purified recombinant protein of Human activin A receptor, type IC (ACVR1C), transcript variant 1, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.